DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and srsf9

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001299828.1 Gene:srsf9 / 405835 ZFINID:ZDB-GENE-040426-2397 Length:245 Species:Danio rerio


Alignment Length:265 Identity:57/265 - (21%)
Similarity:102/265 - (38%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYV 159
            :.:..||.|:.:|::.:||...|.|...::..:..|   ..:.||.::...|:|||:...||:..
Zfish     6 IYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRST---IPFAFVRFEDPRDAEDAVFGRNGYGF 67

  Fly   160 RNKRLKVSYARPGGQSIKD---------------------------TNLYVINLSRNINDDMLDR 197
            .:.:|:|.|.|..|.....                           |.|......:::.|.|.:.
Zfish    68 GDCKLRVEY
PRSSGSKFSGPAGGGGGGGPRGRFGPPTRRSEFRVIVTGLPPTGSWQDLKDHMREA 132

  Fly   198 IFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNT-VPEGGSQPIWVRLAEEHG 261
                 |.:...::.||       |...|.:.:||:.:.|::.|::| ......:..::|:.||.|
Zfish   133 -----GDVCFADVQRD-------GEGVVEFLRREDMEYALRRLDSTEFRSHQGETAYIRVMEERG 185

  Fly   262 KAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNP--HMPP-HHHQPQHPHQ 323
                ..:..........|...||:...|.|  ||.:.:...|...|:|  ..|| .||.|.    
Zfish   186 ----TSWGRSRSRSRSRGRYTPPYQSRGSP--PPRYRSPPRHMTRHSPPSRRPPLQHHSPP---- 240

  Fly   324 HPQHH 328
             |:|:
Zfish   241 -PRHY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/77 (27%)
RRM_SF 179..257 CDD:302621 15/78 (19%)
srsf9NP_001299828.1 RRM <1..>76 CDD:223796 19/72 (26%)
RRM1_SRSF9 5..76 CDD:241042 19/72 (26%)
RRM_SF 109..184 CDD:302621 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.