| Sequence 1: | NP_569908.1 | Gene: | ssx / 31086 | FlyBaseID: | FBgn0024987 | Length: | 485 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261874.1 | Gene: | cocoon / 39665 | FlyBaseID: | FBgn0036496 | Length: | 318 | Species: | Drosophila melanogaster | 
| Alignment Length: | 345 | Identity: | 75/345 - (21%) | 
|---|---|---|---|
| Similarity: | 125/345 - (36%) | Gaps: | 88/345 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    21 EGSGDN----VGRDDGT-------DDDDDSNGNMQQENGD-----GGNGGDGQEHSGDEE----Q 65 
  Fly    66 HH------------SQDNEGNDNSAGQQQQMQQVDRTSA----TNLIINYLPQDMTDRELYNLFS 114 
  Fly   115 GCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDT 179 
  Fly   180 NLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRP-RGVAFVRYNKREEAQEAIKALNNT 243 
  Fly   244 VPEGGSQPIWVRLAEEH-----------GKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHH 297 
  Fly   298 HNNHHHNNHHNPHMPPHHHQ 317 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ssx | NP_569908.1 | RRM_SF | 93..173 | CDD:302621 | 20/79 (25%) | 
| RRM_SF | 179..257 | CDD:302621 | 16/78 (21%) | ||
| cocoon | NP_001261874.1 | RRM1_TDP43 | 108..184 | CDD:240767 | 19/75 (25%) | 
| RRM2_TDP43 | 193..262 | CDD:240768 | 18/93 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45439623 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||