DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Srsf4

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001102155.1 Gene:Srsf4 / 362612 RGDID:1561347 Length:488 Species:Rattus norvegicus


Alignment Length:190 Identity:46/190 - (24%)
Similarity:73/190 - (38%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 INYLPQDMTDRELYNLFSGCGPINTCKIMR-DFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVR 160
            |..|.....:|::...|.|.|     ||:. |.|.    |||||::....|::||:.:|||..:.
  Rat     6 IGRLSYQARERDVERFFKGYG-----KILEVDLKN----GYGFVEFDDLRDADDAVYELNGKDLC 61

  Fly   161 NKRLKVSYARP------------------------GGQSIKDTNLYVINLSRNINDDMLDRIFSP 201
            .:|:.|.:||.                        |..:..:..|.|.|||...:...|......
  Rat    62 GERVIVEHARG
PRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQ 126

  Fly   202 YGLIVQRNILRDKLTGRPRG--VAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEE 259
            .|.:.    ..|...||...  :.||.|:   :.:.|::.|:.|...|..    :||.|:
  Rat   127 AGEVT----YADAHKGRKNEGVIEFVSYS---DMKRALEKLDGTEVNGRK----IRLVED 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/100 (25%)
RRM_SF 179..257 CDD:302621 18/79 (23%)
Srsf4NP_001102155.1 RRM1_SRSF4_like 3..72 CDD:240783 24/74 (32%)
RRM2_SRSF4_like 104..175 CDD:241044 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.