DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and CG10466

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:111 Identity:29/111 - (26%)
Similarity:53/111 - (47%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTC 122
            ||   |.||            |.::....:.:.||...:..: |..:|:.:|..:||..|.:...
  Fly    15 EH---ELQH------------GGKKSWHDMYKDSAWIFVAGF-PYTLTEGDLVCVFSQYGEVVNI 63

  Fly   123 KIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSY 168
            .::||.|||.|.|:.|:.|:.:..:..|:..|||..:.::.|:|.:
  Fly    64 NLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDH 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/76 (28%)
RRM_SF 179..257 CDD:302621
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 23/86 (27%)
RRM <36..>126 CDD:223796 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.