DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AgaP_AGAP000916

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_555917.2 Gene:AgaP_AGAP000916 / 3289782 VectorBaseID:AGAP000916 Length:261 Species:Anopheles gambiae


Alignment Length:185 Identity:43/185 - (23%)
Similarity:85/185 - (45%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLN 155
            ::|.|.:....:.:.:..|:.||...|.:....:.|..   |.:...:|.:::..|:|:|..:||
Mosquito    57 TSTELHVTNFSEWIDEEVLHELFGRIGRVMQIVMGRSV---YGYREAYVSFRSAMDTEEAHLQLN 118

  Fly   156 GFYVRN---KRLKVSYARPGGQSIK-------DTNLY------VINLSRNINDDMLDRIFSPYGL 204
            |:.:.:   .|::.||...||..:.       .||.:      |..|.::.....|..:|..|||
Mosquito   119 GWDMGDGFALRVRHSYTVHGGAPVSPAEFQRLQTNRFLGGYVRVSGLGQSFGAVRLRELFGTYGL 183

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEE 259
            :...::|||: ...|.|.|.:||...::|....:.::|||.:.....: |:|:.:
Mosquito   184 LRDVSVLRDQ-DREPLGWAILRYQSDKQALFVSRIMDNTVVDDARLKV-VKLSNQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 18/82 (22%)
RRM_SF 179..257 CDD:302621 22/83 (27%)
AgaP_AGAP000916XP_555917.2 RRM_SF 61..131 CDD:240668 15/72 (21%)
RRM_SF 160..230 CDD:240668 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.