DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and tiar-1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_495121.1 Gene:tiar-1 / 173967 WormBaseID:WBGene00015943 Length:408 Species:Caenorhabditis elegans


Alignment Length:394 Identity:93/394 - (23%)
Similarity:165/394 - (41%) Gaps:99/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSGDN------VGRDDGTDDDD------DSNGNMQQEN--GDGGNGGDGQEHSGDEEQHHSQ--- 69
            |:|.:      ||..|.|..:|      :..|::.:..  .||.|    ..::..|...|.|   
 Worm    39 GNGSDEPRTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIFDGSN----DPYAFVEFSDHGQASQ 99

  Fly    70 -----------DNEGNDNSA---GQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPIN 120
                       |.|...|.|   ||||  .::|.|...::.:..|..::.:::|...|...|.::
 Worm   100 ALQTMNKRLLLDREMKVNWAVEPGQQQ--SKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVS 162

  Fly   121 TCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYA--RPGGQ--------- 174
            ..|::||..|..|.|||||.|....::|.||:::||.::..:.::.::|  :||.|         
 Worm   163 DAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEK 227

  Fly   175 ---------SIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKR 230
                     |..:|::||.|:: ::.:|.:.:.|:.:|.|.:..|.      :.:|.|||:::.:
 Worm   228 SYDEIYNQTSGDNTSVYVGNIA-SLTEDEIRQGFASFGRITEVRIF------KMQGYAFVKFDNK 285

  Fly   231 EEAQEAIKALNNTVPEGGSQPI---WVRLAEEHGKAKAAQFMAQIG----GGN------------ 276
            :.|.:||..:||  .:.|.|.:   |.:..:. ||.....:....|    |||            
 Worm   286 DAAAKAIVQMNN--QDVGGQLVRCSWGKTGDT-GKTPGGSYGYGYGNSSSGGNSQPYSGYGGGGA 347

  Fly   277 -GGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPN 340
             |||.||..|.|||        ....:.|:.:..:...:::.||...|...:..|    |...|.
 Worm   348 YGGGQGGGGHGGPG--------QQQSNANSQYWQYYAQYYNNPQLMQQWSNYWQQ----QGGAPQ 400

  Fly   341 NHNN 344
            ..|:
 Worm   401 QQNS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 22/81 (27%)
RRM_SF 179..257 CDD:302621 21/80 (26%)
tiar-1NP_495121.1 PABP-1234 47..>302 CDD:130689 65/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.