DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and Elavl1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034615.2 Gene:Elavl1 / 15568 MGIID:1100851 Length:326 Species:Mus musculus


Alignment Length:211 Identity:91/211 - (43%)
Similarity:128/211 - (60%) Gaps:2/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SAGQQQQMQQ--VDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFV 139
            |.|.:..|.:  .|....||||:|||||:||..||.:|||..|.:.:.|::||...|:|.|||||
Mouse     2 SNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFV 66

  Fly   140 DYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGL 204
            :|.|..|:|.||..|||..:::|.:|||||||..:.|||.|||:..|.|.:....::.:||.:|.
Mouse    67 NYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGR 131

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFM 269
            |:...:|.|:.||..|||||:|::||.||:|||.:.|...|.|.|:||.|:.|....:.|....:
Mouse   132 IINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMALL 196

  Fly   270 AQIGGGNGGGGGGPPH 285
            :|:........|||.|
Mouse   197 SQLYHSPARRFGGPVH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 44/79 (56%)
RRM_SF 179..257 CDD:302621 33/77 (43%)
Elavl1NP_034615.2 ELAV_HUD_SF 19..326 CDD:273741 87/194 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.