DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and AT3G01160

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_566132.2 Gene:AT3G01160 AraportID:AT3G01160 Length:713 Species:Arabidopsis thaliana

Alignment Length:820 Identity:266/821 (32%)
Similarity:393/821 (48%) Gaps:182/821 (22%)


  Fly     1 MGKKKDKSGKLDKQTTKKEAPSSSQANMGKAAGANDSENGIWQDSRFQHLLTDPRFRGVPKVQRK 65
            ||.|..|..|.:   :.:||..||        |..:..|.:.:|.||....|||:||.:.:...|
plant     1 MGSKNKKQRKGE---SIEEAKGSS--------GVAEEGNEMIKDPRFSSAHTDPKFRRMRRRDSK 54

  Fly    66 VKIDKRFQGMFTDDKFKV-KYTVDKYG-RPVNKSNAEDLRKFYELDE-----NESSSGEEPAKKE 123
            |.||.|||.||.|.:|.. ...|||.| |....:..:.||:||.:::     .|..||:|...:.
plant    55 VAIDSRFQPMFNDKRFATGSAPVDKRGKRRTGGTGKDSLREFYRIEDEGKQKTEEESGDESGSET 119

  Fly   124 --SDLDSE--AEAEQQERRAEERAIANLEKEESNDTLESDSSEVSQSLRQRLTNPEIDYARGEGR 184
              :||.||  :..|.:|....|..:|:|: :||::  ::||.|:|....:               
plant   120 EINDLKSEKSSHVESEEESESELKVASLD-DESDE--KADSEELSSQEEE--------------- 166

  Fly   185 LYTDSSSDEDSDD----EDEGPELQIDHVWGELDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVM 245
               :...|.|.||    ||||||:..:::        ...:|.|.|||:.||||..:.|:||.|:
plant   167 ---EEEDDTDEDDEAMYEDEGPEIPEENI--------PLIQEETHRLAIVNMDWRHVSAKDLYVV 220

  Fly   246 LSSFLPPGGSILSVKIYPSEFGKARMAEEEVHGPKELVERVEPEDDSDEELVRQQDSDAEEGEDY 310
            |:||||..|.||||.:||||||..||.|||:|||  :::..:..|.||:|     |.:.||.||.
plant   221 LNSFLPKDGRILSVAVYPSEFGLERMKEEEIHGP--VIDGDKKNDASDDE-----DEEEEEDEDV 278

  Fly   311 HMEKLRQYQLNRLRYYYAVVECDSIDTADKVYKECDGIEYESSATRVDLRFIPDDTSFEEDTPSD 375
            ..:|||.|:::||:||:||.||||..|||.:||.|||||:|.|:.::|||||||...|:. .|.|
plant   279 INQKLRAYEISRLKYYFAVAECDSSATADYLYKSCDGIEFERSSNKLDLRFIPDSMEFKH-PPRD 342

  Fly   376 ECFELPDASSYKPRQFTTTALQQAKVDLTWDETALDR-RELGDKLSSGQVDKLTDKELRQIVAYS 439
            ...|.|  :.|:...|.:.|||.:||:|:|||....| :.|..|.:.   ::|.:.|:::.:|  
plant   343 IASEAP--AGYEGLDFQSRALQMSKVNLSWDEDEPHRIKTLNQKFNP---EQLANLEMKEFLA-- 400

  Fly   440 SEEEDSEAEESPAEEAAQKAVSEDPQKSKPKKTSKQERIATYKNLLADILEQEKKEKEQKYEMEM 504
            |:|.||:.|:....|...::..:|.:|.|.:...:.|.:.:.|:|          |:|...:||:
plant   401 SDESDSDEEDDLGNEVINQSKKKDKKKDKYRALIEAEDVDSDKDL----------EEENDQDMEV 455

  Fly   505 TWNVEPQHEEAQPEQQAQAELTPIEKVIQKRSEKN---------RQRKEQRRQRQIEARGGDAGE 560
            |:|               ..|..:.|.|.|:.:..         |||:|::|.|:.:.:..|:..
plant   456 TFN---------------TGLEDLSKEILKKKDNQSESVWETYLRQRREKKRARKNKQKDDDSSP 505

  Fly   561 DSDE------SMVPDGIDLNDAYFAEEFANGDYAPPKTKQDKKKKKKKGKDDGEEDVEAKRQEKE 619
            |.|:      ..|.|  |.:|.:|.||       ||     .|||||:||...||....::...|
plant   506 DDDDDYNIDRKAVKD--DGDDDFFMEE-------PP-----LKKKKKEGKTKKEEVAAEEKSRAE 556

  Fly   620 LELLLDD---GDGRDEKQHFSLTKILKKEEQEASGSKRKRRQKLKK---SKNQPQNAEKLDDDFQ 678
            |||||.|   |||...|                 |...||:.|..|   |:::...||       
plant   557 LELLLADENAGDGNGLK-----------------GYNIKRKAKKGKTDISEDKIPAAE------- 597

  Fly   679 VNLNDNRFSAVYKSHEYNIDPTHSHYKPTKGMQQIIGEKLKRRKEQGEGGAANGDADGDEQVAPK 743
              |:|.||||::.|..|.:|||...:|.:....:.:..|.|.            |..|.|.|...
plant   598 --LDDPRFSALFSSPYYALDPTDPQFKRSATYARQLALKQKE------------DPKGHEDVKAP 648

  Fly   744 RSKQQL-------------EQNALVKSLKRKIQLQQQGQK 770
            :.||:|             |..:.|||||.|:..:...:|
plant   649 KEKQELNSDGNLGSKKERHELTSTVKSLKMKMMNKDSEKK 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 254/769 (33%)
NUC153 683..711 CDD:285385 11/28 (39%)
AT3G01160NP_566132.2 COG5638 33..677 CDD:227925 252/765 (33%)
NUC153 600..>623 CDD:285385 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1300279at2759
OrthoInspector 1 1.000 T192590
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.