DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and Esf1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001074559.1 Gene:Esf1 MGIID:1913830 Length:845 Species:Mus musculus

Alignment Length:902 Identity:310/903 (34%)
Similarity:449/903 (50%) Gaps:232/903 (26%)


  Fly    37 SENGIWQDSRFQHLLTDPRFRGVPKVQRKVKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNAED 101
            |:..|..|.||:.:..||||..:|:.:|||||||||:.||.|.|||:.|.|||.|||::.|..||
Mouse     3 SKQEIMDDQRFRRVSKDPRFWEMPEKERKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTED 67

  Fly   102 LRKFYELDENESSSGEEPAK-------KESDLDSEAEAEQQERRAEERAIANLEKEESNDTLESD 159
            |::||:|.:::|...:|.:|       |:....::.||:..|:..||:      |:|:..|.:.|
Mouse    68 LKRFYDLSDSDSDLSDEESKILSQKKAKQKKKQTKKEAKSIEKPIEEK------KKETKKTDQKD 126

  Fly   160 S--------SEVSQSLRQRLTNPEID-----------------YARG----------EGRLYT-D 188
            |        ||..|.::......:||                 ..||          :|:|.| |
Mouse   127 SINKHDLNNSERVQKMKNSQKPQKIDSEISPKKDNEEFLQNKKKKRGTTDLSVEALPKGKLRTKD 191

  Fly   189 SS----------------------------------------------------SDEDSDDE--- 198
            ||                                                    |||:|:||   
Mouse   192 SSTSEMVKSSTMSSSKAKREKQSVVPVIMAKDNDGKMPDEDALEEDSDSASELGSDEESEDEIIS 256

  Fly   199 ----------------------------------DEGPELQ------------------------ 205
                                              |.||:|.                        
Mouse   257 DGKTSADEDESEEEDEEEEEDSEEEEEEEEEDESDSGPDLARGKGNVETSSEDEDDLADLFPEEP 321

  Fly   206 -IDHVWGELDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVMLSSFLPPGGSILSVKIYPSEFGKA 269
             .:|.|.|||.||...:|.|||||||||||||::|:||:.:.:||.|.||.:.|||||||||||.
Mouse   322 GFEHAWRELDKDAPRADEITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVVFSVKIYPSEFGKE 386

  Fly   270 RMAEEEVHGPKELVERVEPEDDSDEELVRQQDSDAEEGEDYHMEKLRQYQLNRLRYYYAVVECDS 334
            ||.||:|.||.||:...|               ||.|.:....||||.||..||:|||||.||||
Mouse   387 RMKEEQVQGPVELLSIPE---------------DAPEKDWASREKLRDYQFKRLKYYYAVAECDS 436

  Fly   335 IDTADKVYKECDGIEYESSATRVDLRFIPDDTSFEEDTPSDECFELPDASSYKPRQFTTTALQQA 399
            .:||.|:|::|||:|:|||.:.:||||||||.:| :|.|.|...|: |.::|||:.||:.|:..:
Mouse   437 PETASKIYEDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDVALEV-DLTAYKPKYFTSAAMGTS 499

  Fly   400 KVDLTWDETALDR-RELGDKLSSGQVDKLTDKELRQIVAYSSEEEDSEAEESP-AEEAAQKAVSE 462
            .|::|||||..:| ..|..|...   |:|.|.:.:..:|.|||:|: |.||:| .||...  :.|
Mouse   500 TVEITWDETDHERITTLNRKFKK---DELLDMDFQAYLASSSEDEE-EVEEAPEGEEGVN--IGE 558

  Fly   463 DPQKSKPKKTSK--QERIATYKNLLADILEQEKKEKEQKYEMEMTW---NVEPQHEEAQPEQQAQ 522
            |   .|.||:.|  :|:||.|:.||..|.|:|||.||...|||:.|   ..|...|..:.:.:.:
Mouse   559 D---GKTKKSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPGLKESAEEMVKNKLEGK 620

  Fly   523 AELTPIEKVIQKRSEKNRQRKEQRRQRQIEARGGDAGEDSDESMVPDGIDLNDAYFAEEFANGDY 587
            .:|||.|:.::|:.||.|.:|:|:..         |.|||::.: |..:|.||.|||||.     
Mouse   621 DKLTPWEQFLEKKKEKKRLKKKQKAL---------AEEDSEDEL-PSDVDFNDPYFAEEV----- 670

  Fly   588 APPKTKQDKKKKKKKGKD--DGEEDVEAKRQEKELELLLDDGDGRDEKQHFSLTKILKKEEQEAS 650
               |....|||..|..||  ..||:.:.::|:.|:.||:.| :..|.|:||:..||::.:..   
Mouse   671 ---KKIGIKKKSMKSAKDSASSEEETDLEKQKAEMALLVMD-EEEDSKKHFNYDKIVEHQNL--- 728

  Fly   651 GSKRKRRQKLKKSKNQPQNAEKLDDDFQVNLNDNRFSAVYKSHEYNIDPTHSHYKPTKGMQQIIG 715
             ||:|::|.:||.       |.::|||:||::|.||.|:|.||.:|:||:..::|.||.|::|:.
Mouse   729 -SKKKKKQLMKKK-------ELVEDDFEVNVSDARFQAMYTSHLFNLDPSDPNFKKTKAMEKILE 785

  Fly   716 EKLKRRKEQGEGGAANGDADGDEQVAPKRSKQQLEQ--NALVKSLKRKIQLQQQGQK 770
            || .|.:|:.|...........:.......||.::.  :.|:||:|.|.: |.|.:|
Mouse   786 EK-ARHRERKEELLIQAVERAQQDTGKPTQKQPMDPALSMLIKSVKNKTE-QFQARK 840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 305/887 (34%)
NUC153 683..711 CDD:285385 14/28 (50%)
Esf1NP_001074559.1 COG5638 295..798 CDD:227925 225/560 (40%)
NUC153 753..781 CDD:285385 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316493094
eggNOG 1 0.900 E1_COG5638
Hieranoid 1 1.000
Homologene 1 1.000 H5717
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1082550
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R416
TreeFam 1 0.960
1110.830

Return to query results.
Submit another query.