DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and ESF1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001263309.1 Gene:ESF1 HGNCID:15898 Length:851 Species:Homo sapiens

Alignment Length:918 Identity:307/919 (33%)
Similarity:448/919 (49%) Gaps:258/919 (28%)


  Fly    37 SENGIWQDSRFQHLLTDPRFRGVPKVQRKVKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNAED 101
            |:..|..|.||:.:..||||..:|:..|||||||||:.||.|.|||:.|.|||.|||::.|..||
Human     3 SKQEIMSDQRFRRVAKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTED 67

  Fly   102 LRKFYELDENESS-SGEE--------------PAKKESDLDSEAEAEQQERRAEERAIANL---- 147
            |::||:|.:::|: |||:              ..|||.|..:..|.:::.::|..:...|.    
Human    68 LKRFYDLSDSDSNLSGEDSKALSQKKIKKKKTQTKKEIDSKNLVEKKKETKKANHKGSENKTDLD 132

  Fly   148 ---------------------------------EKEESN-------------------------- 153
                                             :||:.|                          
Human   133 NSIGIKKMKTSCKFKIDSNISPKKDSKEFTQKNKKEKKNIVQHTTDSSLEEKQRTLDSGTSEIVK 197

  Fly   154 ---------------------------------------DTLESDSSEVSQSLRQRLTNPEI--- 176
                                                   |.||.||..||:......:..||   
Human   198 SPRIECSKTRREMQSVVQLIMTRDSDGYENSTDGEMCDKDALEEDSESVSEIGSDEESENEITSV 262

  Fly   177 --------------------------------------DYARGEGRLYTDSSSDEDSDD---EDE 200
                                                  |.|||:|.:.|.|..::|:.|   |:.
Human   263 GRASGDDDGSEDDEEEDEDEEEDEDEDSEDDDKSDSGPDLARGKGNIETSSEDEDDTADLFPEES 327

  Fly   201 GPELQIDHVWGELDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVMLSSFLPPGGSILSVKIYPSE 265
            |    .:|.|.|||.||...:|.|||||||||||||::|:||:.:.:||.|.||.|.||||||||
Human   328 G----FEHAWRELDKDAPRADEITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVIFSVKIYPSE 388

  Fly   266 FGKARMAEEEVHGPKELVERVEPEDDSDEELVRQQDSDAEEGEDYHMEKLRQYQLNRLRYYYAVV 330
            |||.||.||:|.||.||:...|               ||.|.:....||||.||..||:||||||
Human   389 FGKERMKEEQVQGPVELLSIPE---------------DAPEKDWTSREKLRDYQFKRLKYYYAVV 438

  Fly   331 ECDSIDTADKVYKECDGIEYESSATRVDLRFIPDDTSFEEDTPSDECFELPDASSYKPRQFTTTA 395
            :|||.:||.|:|::|||:|:|||.:.:||||||||.:| :|.|.|...|: :.::|||:.||:.|
Human   439 DCDSPETASKIYEDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDVASEV-NLTAYKPKYFTSAA 501

  Fly   396 LQQAKVDLTWDETALDR-RELGDKLSSGQVDKLTDKELRQIVAYSSEEEDSEAEESPAEEAAQKA 459
            :..:.|::|||||..:| ..|..|...   ::|.|.:.:..:|.|||:|:...||...::...  
Human   502 MGTSTVEITWDETDHERITMLNRKFKK---EELLDMDFQAYLASSSEDEEEIEEELQGDDGVN-- 561

  Fly   460 VSEDPQKSKPKKTSK--QERIATYKNLLADILEQEKKEKEQKYEMEMTW---NVEPQHEEAQPEQ 519
            |.||   .|.||:.|  :|:||.|:.||..|.|:|||.||...|||:.|   ..|...|..:.:.
Human   562 VEED---GKTKKSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPGLKESAEEMVKNKL 623

  Fly   520 QAQAELTPIEKVIQKRSEKNRQRKEQRRQRQIEARGGDAGEDSDESMVPDGIDLNDAYFAEEFAN 584
            :.:.:|||.|:.::|:.||.|.:::|:.          ..|::.|..:|..:||||.|||||   
Human   624 EGKDKLTPWEQFLEKKKEKKRLKRKQKA----------LAEEASEEELPSDVDLNDPYFAEE--- 675

  Fly   585 GDYAPPKTKQ--DKKKKKKKGKD--DGEEDVEAKRQEKELELLLDDGDGRDEKQHFSLTKILKKE 645
                   .||  ..||..|..||  ..||::|.:||:.|:.||:.|.| .|.|:||:..||::.:
Human   676 -------VKQIGINKKSVKSAKDGTSPEEEIEIERQKAEMALLMMDED-EDSKKHFNYNKIVEHQ 732

  Fly   646 EQEASGSKRKRRQKLKKSKNQPQNAEKLDDDFQVNLNDNRFSAVYKSHEYNIDPTHSHYKPTKGM 710
            ..    ||:|::|.:||.       |.::|||:||:||.||.|:|.||.:|:||:..::|.||.|
Human   733 NL----SKKKKKQLMKKK-------ELIEDDFEVNVNDARFQAMYTSHLFNLDPSDPNFKKTKAM 786

  Fly   711 QQIIGEKLKR--RKEQGEGGAANGDADGDEQVAPKRSKQQLEQNA-----------LVKSLKRKI 762
            ::|:.||.::  ||||            :...|.|:.:.::|:.:           |:||:|.|.
Human   787 EKILEEKARQRERKEQ------------ELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKT 839

  Fly   763 QLQQQGQK 770
            : |.|.:|
Human   840 E-QFQARK 846

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 302/903 (33%)
NUC153 683..711 CDD:285385 14/28 (50%)
ESF1NP_001263309.1 COG5638 301..836 CDD:227925 240/608 (39%)
NUC153 759..787 CDD:285385 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316491195
eggNOG 1 0.900 E1_COG5638
Hieranoid 1 1.000
Homologene 1 1.000 H5717
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1300279at2759
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1072484
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R416
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.