DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and Esf1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001094241.1 Gene:Esf1 RGDID:1306067 Length:842 Species:Rattus norvegicus

Alignment Length:891 Identity:301/892 (34%)
Similarity:441/892 (49%) Gaps:213/892 (24%)


  Fly    37 SENGIWQDSRFQHLLTDPRFRGVPKVQRKVKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNAED 101
            |:..|..|.||:.:..||||..:|:..|||||||||:.||.|.|||:.|.|||.|||::.|..||
  Rat     3 SKQEIMDDQRFRRVSKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTED 67

  Fly   102 LRKFYELDENESSSGEEPAKKESDLDSEAEAEQQERRAEERAIANLEKEESNDTLESDS------ 160
            |::||:|.:::|...:|.:|...:...:.:.:|.::..:.:.....:|:|:..|.:.||      
  Rat    68 LKRFYDLSDSDSDLSDEESKVLDEKRVKEKKKQTKKETKSKTPIEEKKKETKKTDQKDSINKNDL 132

  Fly   161 --SEVSQSLRQRLTNPEID--------------------------YARGEGRLYT---------- 187
              ||..|.::....:|:||                          .|..:|:|.|          
  Rat   133 NNSERIQKMKNSHKSPKIDSEVSPKDSEESLQSRKKKRDTTDLSVEASPKGKLRTKDPSTSAMVK 197

  Fly   188 ------------------------------------DSSS------------------------- 191
                                                ||:|                         
  Rat   198 SSTVSGSKAKREKQAVIMAKDNAGRMLHEEAPEEDSDSASELGRDEESEGEITSDDRASADDDEN 262

  Fly   192 -------------------DEDSDDEDEGPELQ-------------------------IDHVWGE 212
                               ||..|:.|.||:|.                         .:|.|.|
  Rat   263 EDEEEEEDGEEEEEEEEEEDESDDESDSGPDLARGKGNVETSSEDEDDLADLFPEEPGFEHAWRE 327

  Fly   213 LDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVMLSSFLPPGGSILSVKIYPSEFGKARMAEEEVH 277
            ||.||...:|.|||||||||||||::|:||:.:.:||.|.||.:.|||||||||||.||.||::.
  Rat   328 LDKDAPRADEITRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVVFSVKIYPSEFGKQRMKEEQIQ 392

  Fly   278 GPKELVERVEPEDDSDEELVRQQDSDAEEGEDYHMEKLRQYQLNRLRYYYAVVECDSIDTADKVY 342
            ||.||:...|               ||.|.:....||||.||..||:||||||||||.:||.|:|
  Rat   393 GPVELLSIPE---------------DAPEKDWASREKLRDYQFKRLKYYYAVVECDSPETASKIY 442

  Fly   343 KECDGIEYESSATRVDLRFIPDDTSFEEDTPSDECFELPDASSYKPRQFTTTALQQAKVDLTWDE 407
            ::|||:|:|||.:.:||||||||.:| :|.|.|...|: |.::|||:.||:.|:..:.|::||||
  Rat   443 EDCDGLEFESSCSFIDLRFIPDDITF-DDEPKDAASEV-DLTAYKPKYFTSAAMGTSTVEITWDE 505

  Fly   408 TALDR-RELGDKLSSGQVDKLTDKELRQIVAYSSEEEDSEAEESPAEEAAQKAVSEDPQKSKPKK 471
            |..:| ..|..|...   |:|.|.:....:|.|||:|: |.||:|..|   ..||.:..|:|..:
  Rat   506 TDHERITTLNRKFKK---DELLDMDFEAYLASSSEDEE-EVEEAPEGE---DGVSIEDGKTKKSQ 563

  Fly   472 TSKQERIATYKNLLADILEQEKKEKEQKYEMEMTW---NVEPQHEEAQPEQQAQAELTPIEKVIQ 533
            ...:|:||.|:.||..|.|:|||.||...|||:.|   ..|...|..:.:.:.:.:|||.|:.::
  Rat   564 KDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPGLKESAEEMVKNKLEGKDKLTPWEQFLE 628

  Fly   534 KRSEKNRQRKEQRRQRQIEARGGDAGEDSDESMVPDGIDLNDAYFAEEFANGDYAPPKTKQDKKK 598
            |:.||.|.:|:|:.          ..|::.|..:|..:||||.|||||.        |....|||
  Rat   629 KKKEKKRLKKKQKA----------LAEEASEDEIPSDVDLNDPYFAEEV--------KKIGIKKK 675

  Fly   599 KKKKGKD--DGEEDVEAKRQEKELELLLDDGDGRDEKQHFSLTKILKKEEQEASGSKRKRRQKLK 661
            ..|..||  ..||:.|.::|:.|:.||:.| :..|.|:||:..||::.:..    ||:|::|.:|
  Rat   676 SMKSAKDGATSEEETELEKQKAEMALLVMD-EEEDSKKHFNYDKIVEHQNL----SKKKKKQLMK 735

  Fly   662 KSKNQPQNAEKLDDDFQVNLNDNRFSAVYKSHEYNIDPTHSHYKPTKGMQQIIGEKLKRRKEQGE 726
            |.       |.|:|||:||::|.||.|:|.||.:|:||:..::|.||.|::|:.|| .|.:||.|
  Rat   736 KK-------ELLEDDFEVNVSDARFQAMYTSHLFNLDPSDPNFKKTKAMEKILEEK-ARHREQKE 792

  Fly   727 GGAANGDADGDEQVAPKRSKQQLEQ--NALVKSLKRKIQLQQQGQK 770
            ...........:.......||.::.  :.|:||:|.|.: |.|.:|
  Rat   793 ERLIQAVERAQQDTGKPAQKQPMDPALSMLIKSVKNKTE-QFQARK 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 296/876 (34%)
NUC153 683..711 CDD:285385 14/28 (50%)
Esf1NP_001094241.1 COG5638 293..827 CDD:227925 229/589 (39%)
NUC153 750..778 CDD:285385 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316495797
eggNOG 1 0.900 E1_COG5638
Hieranoid 1 1.000
Homologene 1 1.000 H5717
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1300279at2759
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1086143
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.