DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and esf1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_956039.2 Gene:esf1 ZFINID:ZDB-GENE-030131-4917 Length:757 Species:Danio rerio

Alignment Length:803 Identity:311/804 (39%)
Similarity:460/804 (57%) Gaps:122/804 (15%)


  Fly    37 SENGIWQDSRFQHLLTDPRFRGVPKVQRKVKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNAED 101
            |:|....|.||..:..||||..:|..:||:|||||||.||.|::||:||||||.||||..::.||
Zfish     3 SKNTASGDDRFSKVKKDPRFWEMPNKERKIKIDKRFQSMFHDERFKLKYTVDKRGRPVKHTSTED 67

  Fly   102 LRKFYEL-----------DENESSSGEE-------PAKKESDL--------DSEAEAEQQERRAE 140
            |::||:|           ||:|..:.||       .|.||:::        :.|.|:::.|:..|
Zfish    68 LKRFYKLSDSEQSDDDDDDEDEEKTEEEQKEKRGFEADKEAEVEEDDDDYEEEEGESDESEQEEE 132

  Fly   141 ERAIANLEK--------------------EESNDTLESDSSEVSQSLRQRLTNPEIDYARGEGRL 185
            ::...|.|.                    ||.:|..:.|..|.|.|      .|  |.|||:|.:
Zfish   133 QKIQRNKEAKKTKKGVRVYEEDEDVESGVEEDDDDDDDDDEEESDS------GP--DLARGKGNI 189

  Fly   186 YTDSSSDEDSDDEDEGPEL---------QIDHVWGELDNDAEHTEESTRRLAVCNMDWDRIRAED 241
            .|.|    |.|:||||.|:         :|:|.|||:..||..:::::||||||||||||::|:|
Zfish   190 ETSS----DEDEEDEGDEVEDLLQREKEEIEHDWGEMWKDAPRSDDTSRRLAVCNMDWDRLKAKD 250

  Fly   242 LMVMLSSFLPPGGSILSVKIYPSEFGKARMAEEEVHGPKELVERVE-PEDDSDEELVRQQDSDAE 305
            |:.:.:||.|.||.:|||.:|||||||.|:..|:..||.||....| |:.|:||:.:        
Zfish   251 LLALFNSFKPKGGVVLSVTVYPSEFGKERIHAEQTQGPLELSSLPENPDADTDEQRI-------- 307

  Fly   306 EGEDYHMEKLRQYQLNRLRYYYAVVECDSIDTADKVYKECDGIEYESSATRVDLRFIPDDTSFEE 370
                 :.||:|.||..|||||||||||||.:||.|:|:||||||||:|.:.:||||||||.:| :
Zfish   308 -----YREKVRDYQFKRLRYYYAVVECDSAETASKIYEECDGIEYETSCSMIDLRFIPDDVTF-D 366

  Fly   371 DTPSDECFELPDASSYKPRQFTTTALQQAKVDLTWDETALDR-RELGDKLSSGQVDKLTDKELRQ 434
            |.|.|...:: |..||||:.||:||...:||:||||||..|| ..|..|.:.   |:|.|.:.:.
Zfish   367 DEPKDRATDV-DYGSYKPKLFTSTATTTSKVELTWDETDHDRVSALCRKFNK---DELLDMDFKA 427

  Fly   435 IVAYSSEEEDSEAEESPAEEAAQKAVSEDPQKSKPKKTSKQERIATYKNLLADILEQEKKEK--E 497
            .:|.||||::.|.||........:::.|:.:.||.||.|.|  |..|:.||..|.:::||::  :
Zfish   428 YLASSSEEDEDEEEEQTKAVKPVESLPEEKKASKGKKGSGQ--IDKYRELLKSIQDKDKKKEDDD 490

  Fly   498 QKYEMEMTWNVEPQHEEA-----QPEQQAQAELTPIEKVIQKRSEKNRQRKEQRRQRQIEARGGD 557
            ....||:||  .|..:|:     :.:...:..|||.|:.::|:.||.:::::.::: .:||.   
Zfish   491 NNMNMEITW--VPGLKESTENLVKKKMMGKDRLTPWEEFLEKKKEKKKEKRKGKKE-VVEAE--- 549

  Fly   558 AGEDSDESMVPDGIDLNDAYFAEEFANGDYAPPKTKQDKKKKKKKGKDDGEEDVEAKRQEKELEL 622
             .:.||:.:.|| :||:|.:|.||..:  .|..|.|:.||.:||:.:...||..|.:|::.|:||
Zfish   550 -LQISDDELPPD-VDLSDPFFTEELVS--TASLKNKESKKNRKKEEERTPEEQEEMERRKAEMEL 610

  Fly   623 LLDDGDGRDEKQHFSLTKILKKEEQEASGSKRKRRQKLKKSKNQPQNAEKLDDDFQVNLNDNRFS 687
            |:|| |..|:.:||:..||:  |.|..|   :|:|:||.|| |.|...   .|||:|::.|.||.
Zfish   611 LMDD-DEDDKHKHFNYDKIV--EHQNLS---KKKRKKLLKS-NTPLEE---GDDFKVDVQDPRFQ 665

  Fly   688 AVYKSHEYNIDPTHSHYKPTKGMQQIIGEKLKRRKE---QGEGGAANGDADGDEQVAPKRSKQQL 749
            |::.||.||:||:...||.||..|.|:.||.:||:|   |.|...:....:.|:...|..|...:
Zfish   666 AMFTSHLYNLDPSDPAYKKTKATQSILEEKQRRREEKHSQEETRRSKHTQEEDKTHTPSASSSTM 730

  Fly   750 EQ--NALVKSLKRKIQLQQQGQK 770
            :.  :.|:||:|.|.| |.|.:|
Zfish   731 DPSLSLLIKSVKNKTQ-QFQARK 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 305/788 (39%)
NUC153 683..711 CDD:285385 14/28 (50%)
esf1NP_956039.2 COG5638 8..719 CDD:227925 298/763 (39%)
NUC153 661..689 CDD:285385 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316496219
eggNOG 1 0.900 E1_COG5638
Hieranoid 1 1.000
Homologene 1 1.000 H5717
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1300279at2759
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1051917
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R416
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.