DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and esf1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_595418.1 Gene:esf1 PomBaseID:SPBC1734.01c Length:682 Species:Schizosaccharomyces pombe

Alignment Length:800 Identity:285/800 (36%)
Similarity:409/800 (51%) Gaps:161/800 (20%)


  Fly     1 MGKKKDKSGKLDKQTTKKEAPSSSQANMGKAAGANDSENGIWQDSRFQHLLTDPRFRGVPKVQRK 65
            ||||:.|             |.::::.         ||:.:..|.|||.:.:||||..:.:...|
pombe     1 MGKKQTK-------------PINAKSR---------SESNVVADPRFQSVHSDPRFSRLKRGNFK 43

  Fly    66 VKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNA-EDLRKFYELDENESSSGEEPAKKESDLDSE 129
            ||:|:||:.:..|..||...:||:||||:|:..| :::.:.||| |||.||....:.:.:|.:..
pombe    44 VKVDERFKSLKEDKDFKTTASVDRYGRPLNQDKATKEIDRLYEL-ENEGSSSSSESSEITDNEEV 107

  Fly   130 AEAEQQERRAEERAIANLEKEESNDTLESDSSEVSQSLRQRLTNPEIDYARGEGRLYTDSSSDE- 193
            |.|..:..::||     |..|||.|      .||            .|.|||||.:.|..|||| 
pombe   108 ASASSKSTKSEE-----LTDEESED------EEV------------YDPARGEGIISTSESSDES 149

  Fly   194 DSDDEDEG-PELQIDHVWG-ELDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVMLSSFLPPGGSI 256
            |::.|.|. ||  |..:.| |.:.:.....| |.||||.|||||.::|.||.|.||||.||||.:
pombe   150 DAESETEAQPE--ISELAGIEPEENIPRGSE-TNRLAVVNMDWDNLQAVDLFVALSSFCPPGGKL 211

  Fly   257 LSVKIYPSEFGKARMAEEEVHGP--------------KELVERVE-----PEDDSDEELVRQQDS 302
            |.|.||||||||:|||.|.|.||              .||.|..:     .|.|.|||     |:
pombe   212 LKVSIYPSEFGKSRMAAEHVQGPPRDIFTPADNQPSSAELHEAQKFGFDNNESDQDEE-----DA 271

  Fly   303 DAEE--GEDYHMEKLRQYQLNRLRYYYAVVECDSIDTADKVYKECDGIEYESSATRVDLRFIPDD 365
            ..||  |.::.|.|||||||.|||||||||||||:.||..:|:.|||.|||:||...||||||||
pombe   272 LIEEDLGNEFDMVKLRQYQLERLRYYYAVVECDSVRTAKVIYETCDGAEYETSANIYDLRFIPDD 336

  Fly   366 TSFEEDTPSDECFELPDASSYKPRQFTTTALQQAKVDLTWDETALDRRELGDKLSSGQVDKLTDK 430
            .:|::|...:.|.:.|:  .|:||.|.|.|||.:||.|:||.....|::|..|..:.|  .:.|.
pombe   337 VTFDDDESREVCTKAPE--KYEPRDFVTDALQHSKVKLSWDAEDPHRKDLIKKAFTSQ--DIEDL 397

  Fly   431 ELRQIVAYSSEEEDSEAEESPAEEAAQKAVSEDPQ----KSKPKKTSKQERIATYKNLLADILEQ 491
            :....:| |||.||.:.:  ......||.:|.|..    .|.|                   .|.
pombe   398 DFSAYIA-SSESEDEDVD--VIRSRYQKLLSGDADDFQANSNP-------------------FED 440

  Fly   492 EKKEKEQKYEMEMT----WNVEPQHEEAQPEQQAQAELTPIEKVIQKRSEKNRQRKEQRRQRQIE 552
            :.|.:....|||:|    ::|:.....::.::      |.|||..:|.:|:.::|||   .||::
pombe   441 DDKLEGANGEMEVTFTSGFDVDNNANSSEKDE------TTIEKYKRKAAERKQRRKE---LRQLK 496

  Fly   553 ARGGDAGEDSDESMVPDGIDL--NDAYFAEEFANGDYAPPKTKQDKKKKKKKGKDDGEEDVEAKR 615
            ....|.||.||       :||  :|.:|.::.|:.:          .||.||||....||..|..
pombe   497 KTKDDEGEGSD-------VDLGFDDPFFKDKDASRN----------NKKNKKGKHTQIEDPTAAS 544

  Fly   616 QEKELELLLDDGDGRDEKQHFSLTKILKKEEQEASGSKRKRRQKLKKSKNQPQNAEKLDDDFQVN 680
            :|:...|:.:|.:..::..||.:..|||.|       |.|:.:||||   :..|.|.|.:.|:.:
pombe   545 KEELENLVREDENDSEQLDHFDMKSILKAE-------KFKKNRKLKK---KASNLEGLQEGFEAD 599

  Fly   681 LNDNRFSAVYKSHEYNIDPTHSHYKPTKGMQQIIGEKLKRRKEQGEGGAANGDADGDEQVAPKRS 745
            ::|.||:|:|.:|.:.:|||:.|:|.||.:::|:.|..|||..|.|     ...||..::..|:.
pombe   600 VSDPRFAALYTNHNFALDPTNPHFKRTKTVEKIMDESRKRRSNQLE-----QTQDGKPELKIKKR 659

  Fly   746 K-----QQLEQNALVKSLKR 760
            |     |:.|.:.:|||:||
pombe   660 KAEKGDQRQELDRIVKSIKR 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 277/757 (37%)
NUC153 683..711 CDD:285385 13/28 (46%)
esf1NP_595418.1 COG5638 10..682 CDD:227925 279/778 (36%)
NUC153 602..630 CDD:285385 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1124362
orthoMCL 1 0.900 OOG5_128148
Panther 1 1.100 LDO PTHR12202
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R416
TreeFam 1 0.960
88.000

Return to query results.
Submit another query.