DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11417 and esf1

Sequence 1:NP_569906.1 Gene:CG11417 FlyBaseID:FBgn0024364 Length:771 Species:Drosophila melanogaster
Sequence 2:XP_012818095.1 Gene:esf1 XenbaseID:XB-GENE-5797558 Length:809 Species:Xenopus tropicalis

Alignment Length:867 Identity:305/868 (35%)
Similarity:457/868 (53%) Gaps:197/868 (23%)


  Fly    37 SENGIWQDSRFQHLLTDPRFRGVPKVQRKVKIDKRFQGMFTDDKFKVKYTVDKYGRPVNKSNAED 101
            |:..:..|.||..:..||||..:|:..:|:||||||:.||.|.||.::|||||.|||:|.:..||
 Frog     3 SKTNLASDQRFSQVTKDPRFWEMPERDKKIKIDKRFRAMFHDKKFNLQYTVDKRGRPINHNTTED 67

  Fly   102 LRKFYELDENESSSGE------------------------EPAK--------------------- 121
            |::||:|.:::....|                        ||.|                     
 Frog    68 LKRFYDLSDSDDEESEDRGPSSSKTVKQKGKKKTNKDLESEPPKTKAKELMAKNGKLKATQESNR 132

  Fly   122 -------------------------------------------KESDLDS---EAEAEQQERRAE 140
                                                       :|||.:.   |.|:|:.|.:::
 Frog   133 DEGEQKLKGKEKAGLTQSKQKNTHIPLKDTKYSSTQSNKIVPQRESDTEESGLEDESEESESQSD 197

  Fly   141 ER--------AIANLEKEESNDTLESDSSEVSQSLRQR-----LTNPEIDYARGEGRLYTDSSSD 192
            ..        :.|..|:.||:|..|.:|.|..:..::.     .::...|.|||:|.: ..||.|
 Frog   198 SEDFEGQVLGSDAESEEAESDDESEEESGEDEEGSQEEDDEEDESDSGPDLARGKGNI-ESSSED 261

  Fly   193 EDSDDEDE--GPELQIDHVWGELDNDAEHTEESTRRLAVCNMDWDRIRAEDLMVMLSSFLPPGGS 255
            ||.||.:|  ..|.:|:|.|.|||.||...:|.|.|||||||||||::|:||:.:.:||.|.||.
 Frog   262 EDDDDSNELLQKEPEIEHDWRELDKDAPRGDEVTNRLAVCNMDWDRLKAKDLLALFNSFKPKGGI 326

  Fly   256 ILSVKIYPSEFGKARMAEEEVHGPKELVERVEPEDDSDEELVRQQDSDAEEGEDYHMEKLRQYQL 320
            |.||||||||:||.|:.|||:|||:|| ::|. ||.|||:.:             ..||||:||.
 Frog   327 IFSVKIYPSEYGKERLKEEELHGPQEL-KKVS-EDTSDEQGI-------------FKEKLREYQF 376

  Fly   321 NRLRYYYAVVECDSIDTADKVYKECDGIEYESSATRVDLRFIPDDTSFEEDTPSDECFELPDASS 385
            .||:|||||||||:.:||:|:|:||||:|:|||.:.|||||||:|..| .|.|.|...:: |.|:
 Frog   377 KRLKYYYAVVECDTPETANKIYEECDGLEFESSCSFVDLRFIPNDVKF-ADEPKDSAIDV-DLSA 439

  Fly   386 YKPRQFTTTALQQAKVDLTWDETALDR-RELGDKLSSGQVDKLTDKELRQIVAYSS-EEEDSEAE 448
            |||:.||::|:..:||::|||||..|| ..|.......::   .|.:.:..:|.|| |||||:.:
 Frog   440 YKPKLFTSSAVATSKVEITWDETDHDRITTLNRPFKKNEI---LDMDFQAYLASSSEEEEDSDPD 501

  Fly   449 ESPAEEAAQKAVSEDPQKSKPKKTSK--QERIATYKNLLADILEQEKKEKEQKYEMEMTWNVEPQ 511
            .:...|      :||   :|.||:||  :|:||.|:.||..|..:|||.::...:||:.| |...
 Frog   502 MASCSE------NED---TKSKKSSKDDEEQIARYRELLKSINNKEKKNEDNDMDMEIKW-VPGL 556

  Fly   512 HEEAQPEQQAQAE------LTPIEKVIQKRSEKNR-QRKEQRRQRQIEARGGDAGE---DSDESM 566
            .|.|  ||..:::      |||.||.:||:.:|.: ::|::.:|:|......||.|   |.|:..
 Frog   557 KESA--EQMVKSKLDGKDNLTPWEKYLQKKKDKRKIKKKDKDKQKQHPEEEEDAKEDDDDDDDDE 619

  Fly   567 VPDGIDLNDAYFAEEFANGDYAPPKTKQDKKKKKKKGKDD---GEEDVEAKRQEKELELLLDDGD 628
            :|..:||||.||:||.         .|...|.|...||.|   .|::.|.::::.::.||:.| |
 Frog   620 IPSDVDLNDPYFSEEL---------RKPGLKAKSSSGKKDNQSSEDEAEKEKEKAQIALLMMD-D 674

  Fly   629 GRDEKQHFSLTKILKKEEQEASGSKRKRRQKLKKSKNQPQNAEKLDDDFQVNLNDNRFSAVYKSH 693
            ..|:::||:..||::::..    ||||::|..||.       |.::|:||:|:.|:||.|:|.||
 Frog   675 VEDDRKHFNYDKIVEQQNL----SKRKKKQLKKKE-------ELVEDEFQINVEDSRFQAMYTSH 728

  Fly   694 EYNIDPTHSHYKPTKGMQQIIGEKLKRRKEQGEGGAANGDADGDEQVAPKRSKQQLEQ------- 751
            .|:|||:...:|.||.|.:::.||.:||:::.|          ....|.||...:||.       
 Frog   729 LYSIDPSDPSFKKTKAMGRVLEEKARRREKEQE----------SRTEAVKRHAAELEAHQKKGTD 783

  Fly   752 ---NALVKSLKRKIQLQQQGQK 770
               :.|:||:|.|.|..|..:|
 Frog   784 PALSMLLKSVKNKTQQFQASKK 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11417NP_569906.1 COG5638 44..763 CDD:227925 301/852 (35%)
NUC153 683..711 CDD:285385 15/28 (54%)
esf1XP_012818095.1 COG5638 272..761 CDD:227925 223/542 (41%)
NUC153 718..745 CDD:285385 14/27 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C316492448
eggNOG 1 0.900 E1_COG5638
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1300279at2759
OrthoFinder 1 1.000 FOG0004428
OrthoInspector 1 1.000 T1058572
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R416
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.