DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and NSI

DIOPT Version :10

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_973950.1 Gene:NSI / 840099 AraportID:AT1G32070 Length:258 Species:Arabidopsis thaliana


Alignment Length:204 Identity:41/204 - (20%)
Similarity:69/204 - (33%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QPPS---DYAEGATPTITAQLQLPEPAIS---ADEIVYKEYEAEHQMHDIMRLIQAELSEPYSIY 258
            :|||   |..|...|.:..:..|.|..:.   .:||::.. ..|..::|:..|...         
plant    72 EPPSIVNDEEEETEPLLPVEFTLVERNLEDGLVEEIIFSS-GGEIDVYDLQGLCDK--------- 126

  Fly   259 TYRYFIYNWPK---LCFLASHDNQYVGAIVCKL-------------DMHMNVRRGYIAM------ 301
                  ..||:   :...|:..|.|:.|.:..:             |......:..|.|      
plant   127 ------VGWPRRPLVKLAAALKNSYMVATLHSVMKSSSDSDSSEGGDGEKQQEKKLIGMARATSD 185

  Fly   302 ---------LAVRKEYRKLKIGTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRD- 356
                     :.|..||:...:|..||.|.:.|:|..:...:.|   ..:...:..|:||||..| 
plant   186 HAFNATIWDVLVDPEYQGQGLGKALVEKLVRALLQRDIGNISL---FADSQVVDFYQNLGFEADP 247

  Fly   357 ---KRLFRY 362
               |.:|.|
plant   248 EGIKGMFWY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 Acetyltransf_1 240..353 CDD:395465 24/143 (17%)
NSINP_973950.1 yhbS <175..254 CDD:442387 19/81 (23%)

Return to query results.
Submit another query.