DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and naa10

DIOPT Version :10

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_998499.1 Gene:naa10 / 406643 ZFINID:ZDB-GENE-040426-2648 Length:224 Species:Danio rerio


Alignment Length:139 Identity:45/139 - (32%)
Similarity:74/139 - (53%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DIMRLIQAE---LSEPYSIYTYRYFIYNWPKLCFLASHDN-QYVGAIVCKLDMHM-NVRRGYIAM 301
            |:|.:....   |.|.|.:..|.|...:||:|.::|..:| :.||.::.|::... :|..|:|..
Zfish    10 DLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITS 74

  Fly   302 LAVRKEYRKLKIGTTLVTKAIEAMLAD-NADEVVLETEMRNQPALRLYEN-LGFVRDKRLFRYYL 364
            |||::.:|:|.:...|:.:|..||:.: ||..|.|.....|:.||.||.| |.|...:...:||.
Zfish    75 LAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYA 139

  Fly   365 NGVDALRLK 373
            :|.||..:|
Zfish   140 DGEDAYAMK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 Acetyltransf_1 240..353 CDD:395465 38/117 (32%)
naa10NP_998499.1 RimI 54..152 CDD:440224 32/95 (34%)

Return to query results.
Submit another query.