DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Nat8b

DIOPT Version :10

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:78 Identity:22/78 - (28%)
Similarity:35/78 - (44%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 LAVRKEYRKLKIGTTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLF---RYY 363
            |||..::|...|...||...::........:|||||......|:.||..:||.:..:.|   .:.
  Rat   142 LAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTMQIGAVTLYLGMGFQKTGQYFPSMLWR 206

  Fly   364 LNGVDALRLKLWF 376
            |.|:..::|...|
  Rat   207 LVGIRFVQLNYSF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 Acetyltransf_1 240..353 CDD:395465 15/50 (30%)
Nat8bNP_598242.1 hydrophobic domain 36..80
ArgA 97..198 CDD:440859 17/55 (31%)
consensus motif D 109..126
consensus motif A 131..166 7/23 (30%)
consensus motif B 174..194 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.