DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CBL9

DIOPT Version :10

Sequence 1:NP_569899.3 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_199521.1 Gene:CBL9 / 834756 AraportID:AT5G47100 Length:213 Species:Arabidopsis thaliana


Alignment Length:94 Identity:18/94 - (19%)
Similarity:31/94 - (32%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSIFNATLGAETSDPFFLNTSAAGNPTKGTENPPVEGGF----MAYLMFALSIISCIGYYVSSSV 72
            |.:.:||.|.:... :..|..:...|:......||...|    ..:.......:.|:||  ....
plant    17 LEVCSATDGIQLQS-YMPNVCSEREPSIAAHKQPVIQAFSRMVKVWKQGCAGQMWCVGY--ERRT 78

  Fly    73 CAYIAIRNKKRKKQQQMMENSPGETTTQG 101
            ..||..|.......:.:.:..||.:...|
plant    79 AYYITYRTVYSMDYKSVNKCCPGWSQRNG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_569899.3 FRQ1 25..>139 CDD:444056 14/81 (17%)
CBL9NP_199521.1 FRQ1 49..179 CDD:444056 12/61 (20%)

Return to query results.
Submit another query.