DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and SOS3

DIOPT Version :10

Sequence 1:NP_569899.3 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_197815.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:205 Identity:39/205 - (19%)
Similarity:75/205 - (36%) Gaps:75/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDR--------HQRGYLTPTDLLRIPQLSL-------NPLHRQIIDGF 70
            |..:.|::|.|:..|:.|..        |:..:          ||:|       |....:|.|.|
plant    29 TPFTVEEVEALYELFKKLSSSIIDDGLIHKEEF----------QLALFRNRNRRNLFADRIFDVF 83

  Fly    71 FPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQI 135
            ...|  :..|.|.:||.:.. :..|.   ..|.      :|::...|::|.|::|.|.|.:.:::
plant    84 DVKR--NGVIEFGEFVRSLG-VFHPS---APVH------EKVKFAFKLYDLRQTGFIEREELKEM 136

  Fly   136 MRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVDR- 199
            :.::                |.|:.|...|..::::..:||                  |..|| 
plant   137 VVAL----------------LHESELVLSEDMIEVMVDKAF------------------VQADRK 167

  Fly   200 ---RLSIAKW 206
               ::.|.:|
plant   168 NDGKIDIDEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_569899.3 FRQ1 25..>139 CDD:444056 27/128 (21%)
SOS3NP_197815.1 FRQ1 53..181 CDD:444056 33/181 (18%)

Return to query results.
Submit another query.