DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and CHL1

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_015317.1 Gene:CHL1 SGDID:S000005929 Length:861 Species:Saccharomyces cerevisiae

Alignment Length:952 Identity:297/953 (31%)
Similarity:462/953 (48%) Gaps:207/953 (22%)


  Fly    15 AQEFGFPYSPYEIQEQLMQELFQVLERG-QVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEM 78
            ::.|..||.||:||.|||:.:::||..| ::.|.||||||||:|:|.|..:|||..::..:.|.|
Yeast     7 SETFYHPYKPYDIQVQLMETVYRVLSEGKKIAILESPTGTGKTLSLICATMTWLRMNKADIFTRM 71

  Fly    79 LARIRGVEQELAKLKEESEQSSNW-LESQGKSRAQ-RAELLR--LQHLQAL-------------L 126
            ...|:..|.:...|   |:...:| :::..||..| :.:||.  .:||..:             |
Yeast    72 ETNIKTNEDDSENL---SDDEPDWVIDTYRKSVLQEKVDLLNDYEKHLNEINTTSCKQLKTMCDL 133

  Fly   127 DKQE---QQLDQIRKGAKKHKRQGRVH-PGKLEELEKDLDP---ESDSDSEHET--------ADG 176
            ||:.   :.:|.:||     ||:|..| ...||  |:|..|   ||||::...:        :|.
Yeast   134 DKEHGRYKSVDPLRK-----KRKGARHLDVSLE--EQDFIPRPYESDSENNDTSKSTRGGRISDK 191

  Fly   177 PQEAAE-----------------------DRY-----RPVQIFFCSRTHSQLAQIVAELR----- 208
            ..:.:|                       ||:     .||:|::.|||:|||.|..::||     
Yeast   192 DYKLSELNSQIITLLDKIDGKVSRDPNNGDRFDVTNQNPVKIYYASRTYSQLGQFTSQLRLPSFP 256

  Fly   209 -----KTPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEA 268
                 |.| .:.|:.:.|.|::|||.||.|.|.|.:..:|:.|.|:       ..||:..:..:.
Yeast   257 SSFRDKVP-DEKVKYLPLASKKQLCINPKVMKWKTLEAINDACADL-------RHSKEGCIFYQN 313

  Fly   269 NS---RCPFKAASLVESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLL 330
            .:   .||...|     |||:..:|..|||:|...|.:.|.|.|||||.|:..|:::.||||.||
Yeast   314 TNEWRHCPDTLA-----LRDMIFSEIQDIEDLVPLGKSLGICPYYASREALPIAEVVTLPYQYLL 373

  Fly   331 QKSARNQLGISLKGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKVQISGYKDHFQKRF---TT 392
            .:|.|:.|.|:|:.||||:||||||::::..::.|:||.:.|:.....|..|.:.|:.|.   ..
Yeast   374 SESTRSSLQINLENSIVIIDEAHNLIETINSIYSSQISLEDLKNCHKGIVTYFNKFKSRLNPGNR 438

  Fly   393 KNLLKINQII-----FIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFF---NID---LCELL 446
            .||||:|.::     ||::...||   .:|:..|              |.|   |||   :.:||
Yeast   439 VNLLKLNSLLMTLIQFIVKNFKKI---GQEIDPN--------------DMFTGSNIDTLNIHKLL 486

  Fly   447 DFCARTRFARKVQGRADRMEREPRPSENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDINK 511
            .:...::.|.|:.            :.|||                  |||              
Yeast   487 RYIKVSKIAYKID------------TYNQA------------------LKE-------------- 507

  Fly   512 EDKAEELQEQQKPTKKPVEEVAPSPIRPLL----AFLETLTSNAEDGRILVDPVGGTLKYILLDP 572
                ||..:.:.|.|:..::...|  :|||    .||..||:...:|:...:. ..::||:||:|
Yeast   508 ----EESSKNENPIKETHKKSVSS--QPLLFKVSQFLYCLTNLTSEGQFFFEK-NYSIKYMLLEP 565

  Fly   573 AEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGC-HDRLVERFYNHVVANDAILPFVISNGPSG 636
            ::.|..|:.:|:.:|:|||||:|..|....|.... .:.:.....|||:..:.:..: |:|.|. 
Yeast   566 SKPFESILNQAKCVVLAGGTMEPMSEFLSNLLPEVPSEDITTLSCNHVIPKENLQTY-ITNQPE- 628

  Fly   637 APLSFKFAHRGSAEML-RELSMILRNLCQVVP--GGVVCFLPSYEYLDKVYKYLEQSGTLETISG 698
              |.|.|..|.|..:: ..|.....:|.:.||  ||:|.|.|||:||..|.:..:|:....|::.
Yeast   629 --LEFTFEKRMSPSLVNNHLFQFFVDLSKAVPKKGGIVAFFPSYQYLAHVIQCWKQNDRFATLNN 691

  Fly   699 RKSVFREVSGSAEQLLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNS 763
            .:.:|.|.. ..:.:|..|:.::..  ..|:|||::||||||||:||.|||.|||::||||:.|.
Yeast   692 VRKIFYEAK-DGDDILSGYSDSVAE--GRGSLLLAIVGGKLSEGINFQDDLCRAVVMVGLPFPNI 753

  Fly   764 LSPELRQRMQHLDEKLGPGAG---------NEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKR 819
            .|.||..:.:||..|:....|         .|:.||:|:|||||.:|||:||..|||.:||||.|
Yeast   754 FSGELIVKRKHLAAKIMKSGGTEEEASRATKEFMENICMKAVNQSVGRAIRHANDYANIYLLDVR 818

  Fly   820 FADPKIRGKLPKWISRHIVEANAANGGFGAVQGRTARFFKGR 861
            :..|..|.||.:|:...|...:..:    .|...|.:||..|
Yeast   819 YNRPNFRKKLSRWVQDSINSEHTTH----QVISSTRKFFSMR 856

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 292/931 (31%)
DEXDc2 16..394 CDD:214693 145/455 (32%)
Helicase_C_2 659..836 CDD:290046 78/188 (41%)
CHL1NP_015317.1 DEXDc2 8..438 CDD:214693 145/453 (32%)
rad3 136..849 CDD:273169 248/812 (31%)
SPFH_like 415..>507 CDD:302763 30/139 (22%)
Helicase_C_2 651..835 CDD:290046 78/187 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53811897
eggNOG 1 0.900 E1_COG1199
Hieranoid 1 1.000
Homologene 1 1.000 H68973
Inparanoid 1 1.050 346 1.000 Inparanoid score I394
Isobase 1 0.950 0 Normalized mean entropy S1862
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004084
OrthoInspector 1 1.000 T1136981
orthoMCL 1 0.900 OOG5_127999
Panther 1 1.100 LDO PTHR11472
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R199
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.