DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and AT1G79890

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_178107.1 Gene:AT1G79890 AraportID:AT1G79890 Length:882 Species:Arabidopsis thaliana

Alignment Length:960 Identity:321/961 (33%)
Similarity:459/961 (48%) Gaps:211/961 (22%)


  Fly    16 QEF-GFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEML 79
            :|| .|||.||.||...|..|:|.|::|.|.:.||||||||||::.|.||.||...:|       
plant     5 REFPAFPYKPYSIQIDFMNALYQFLDKGGVSMLESPTGTGKSLSIICSALQWLTDRKE------- 62

  Fly    80 ARIRGVEQELAKLK-EESEQSSNWL------ESQGK-----------------------SRAQRA 114
            .|..|:.:|..|:. .:.|...:|:      |:.|.                       :..::|
plant    63 KRNSGLTEESHKVDGNDDEDEPDWMRNFTLNEADGANGDKSIKNTKSPFSLRKHAKEVFTEGEKA 127

  Fly   115 ELLRLQHLQALLDKQEQQLDQIRKGAKKHKRQGRVHPGKLEELEKDLDPESDSDSEHETADGPQE 179
            :.|..|  :.|||:.|.| |:...|....||:    |.      :..|..|..|.|.|     .:
plant   128 DELNDQ--EFLLDEYESQ-DESSPGGGNSKRK----PA------RGFDSSSSEDEEDE-----ND 174

  Fly   180 AAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNE 244
            .::|.....::||||||||||:|.|.|||||...:.::.:.||||:.||.|..|.||.:|..:||
plant   175 CSDDEQGGFKVFFCSRTHSQLSQFVKELRKTVFAKKLKVVCLGSRKNLCINEDVLKLGNVTRINE 239

  Fly   245 RCLDMATKKARPNPSKKSRLTA-------EANSRCP----------FKAASLVESLRDLALTEPL 292
            ||||:..||. ...|||..|.|       :|:.|||          |||.|..:        |.:
plant   240 RCLDLQKKKI-SQVSKKKNLGANVRIVRTKASCRCPMLRKHKLQREFKAESFQQ--------EAM 295

  Fly   293 DIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVDEAHNLLD 357
            |||:|...|.....|.||.||.....|.|::||||.||.||:|..||:|||.|:||:||||||.|
plant   296 DIEDLVQLGREMRTCPYYGSRRMAPAADLVILPYQSLLSKSSRESLGLSLKNSVVIIDEAHNLAD 360

  Fly   358 SVAQLHGSEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQS-- 420
            ::..:|.::::..|||.....|..|...||......|...|..::.:.|..||.|...:.|.|  
plant   361 TLLSMHDAKLTVSQLEDIHCSIESYLGRFQNLLGAGNRRYIQIMLILTRAFLKPLASDRNLSSVN 425

  Fly   421 --------------NGCSMMRTYELTAEGDFFNIDLCELLDFCARTRFARKVQGRADRMEREPRP 471
                          ..|| |..|:.....:..||:|.:||.:...:....||.|..:|:      
plant   426 VGLDTENPSKSKPCGACS-MAIYDFLFSLNIDNINLVKLLAYIKESNIIHKVSGYGERV------ 483

  Fly   472 SENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPSP 536
                                                       |..||      |.||.....|.
plant   484 -------------------------------------------AAMLQ------KDPVAHEEMSK 499

  Fly   537 IRPLLAF---LETLTSNAEDGRILVDPV--------GGTLKYILLDPAEQFADIVAEARAIVIAG 590
            :....||   |..||:|..||||::...        ||.:||::|..|:.|:::|.||.|:::||
plant   500 LTSFRAFSDMLVALTNNNGDGRIIISRTSSSTSGQHGGYIKYVMLTGAKLFSEVVDEAHAVILAG 564

  Fly   591 GTMQPTKELKEQLFTGCHDRLVERF-YNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRE 654
            ||:||.:|.:|:||.......::.| .:|:|..::|:|..:|:||||....|..:.|.|..|::|
plant   565 GTLQPIEETRERLFPWLPSNQLQFFSCSHIVPPESIMPIAVSHGPSGQSFDFSHSSRSSIGMIQE 629

  Fly   655 LSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFRE--VSGSAEQLLDNY 717
            |.:::.||..|||.|::.|..|:||..:|:.....||.|..|..:|.||||  .:...|.:|.:|
plant   630 LGLLMSNLVAVVPEGIIVFFSSFEYETQVHTAWSNSGILRRIVKKKRVFREPRKNTEVEAVLRDY 694

  Fly   718 ALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHL------- 775
            ..||:  :..||::|:|||||:|||:||:|.:.|.|::|||||.:....||.:|::|:       
plant   695 KEAIE--SERGAIMLAVVGGKVSEGINFSDSMCRCVVMVGLPYPSPSDIELLERIKHIEGRADSD 757

  Fly   776 ----------------DEKLGPGA-------GNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLD 817
                            |.:.|.|.       |.|||||||:|||||.||||:||.||||.:.|:|
plant   758 SIKPSVTLVDDSYYSGDVQAGFGVLKSCKRRGKEYYENLCMKAVNQSIGRAIRHEKDYASILLVD 822

  Fly   818 KRFA-DPKIR-------GKLPKWISRHIVEANAANGGFGAVQGRTARFFK 859
            .|:: ||..|       .||||||...::.:..   |:|.|.....:|||
plant   823 ARYSNDPSKRTSHSHPSNKLPKWIKDRLIYSTK---GYGDVHRLLHQFFK 869

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 315/941 (33%)
DEXDc2 16..394 CDD:214693 152/426 (36%)
Helicase_C_2 659..836 CDD:290046 88/217 (41%)
AT1G79890NP_178107.1 DinG 1..846 CDD:224120 314/933 (34%)
DEAD_2 187..375 CDD:284209 87/197 (44%)
Helicase_C_2 636..849 CDD:290046 88/215 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68973
Inparanoid 1 1.050 420 1.000 Inparanoid score I423
OMA 1 1.010
OrthoDB 1 1.010 D186062at2759
OrthoInspector 1 1.000 T192290
orthoMCL 1 0.900 OOG5_127999
Panther 1 1.100 LDO PTHR11472
Phylome 1 0.910 0.857 Consistency score
98.980

Return to query results.
Submit another query.