DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and BRIP1

DIOPT Version :8

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_011523634.1 Gene:BRIP1 / 83990 HGNCID:20473 Length:1269 Species:Homo sapiens

Alignment Length:969 Identity:242/970 (25%)
Similarity:393/970 (41%) Gaps:232/970 (24%)


  Fly    12 TPGAQEFGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTW---------- 66
            |.|..:..|||..|..|..:|..:.:.|...|..:.|||||:||||.|.|.||.|          
Human     9 TIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGKPAD 73

  Fly    67 --------------LARH-EELVRTEM-LARIRGVEQELAKLKEESEQSSNWLESQGK------- 108
                          .|.| ::....:| ....|..........|.:..||...:|..|       
Human    74 EGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKL 138

  Fly   109 SRAQRAELLRLQHLQALLDKQE----QQLDQIRK----GAKKHKRQGRVHPGKLEELEKDLD--- 162
            |..::|.:.|.::....::|:.    :...||||    |.:.|....:|..||..:|...|:   
Human   139 SAKKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKIN 203

  Fly   163 ---PE------------SDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPH 212
               |:            :...:..|:::..::....:.:..:|:|.:|||.|:|||..|||:|.:
Human   204 SFSPQKPPGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAY 268

  Fly   213 GQSVRSISLGSRQQLCGNPAVRKLKHVGLM--NERCLDMATKKARPNPSKKSRLTAEANSRCPFK 275
             ..|....|.||...|.:|.|     ||..  ||:|:::              |..:....|.|.
Human   269 -SGVPMTILSSRDHTCVHPEV-----VGNFNRNEKCMEL--------------LDGKNGKSCYFY 313

  Fly   276 AASLVESLRD-------LALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKS 333
            ..  |..:.|       ..:.:..|||||.:.|.....|.||.:|..::.|.:|..||..||...
Human   314 HG--VHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQ 376

  Fly   334 ARNQLGISLKGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKVQISGY-------KDHFQKRFT 391
            .|..:.::||..:||:|||||:.|...:.....::..||..|:.::...       |||      
Human   377 IRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDH------ 435

  Fly   392 TKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTA----EGDFFNIDLCELLDFCART 452
                                    :.|::..||::...|..|    |.|:.:  .|::..     
Human   436 ------------------------EPLRAVCCSLINWLEANAEYLVERDYES--ACKIWS----- 469

  Fly   453 RFARKVQGRADRMEREPRPSENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDINKEDKAEE 517
                         ..|...:.::..::||...|||...|....||:      ::..|..:::|.|
Human   470 -------------GNEMLLTLHKMGITTATFPILQGHFSAVLQKEE------KISPIYGKEEARE 515

  Fly   518 LQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSN-AEDGRILV-------------DPVG------ 562
            :     |......::....:..:|.:|....|. |:|.:|.:             |..|      
Human   516 V-----PVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPK 575

  Fly   563 -----------GTLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQL---FTGCHDRLVE 613
                       ..|.:..|:||..|:||..:.:.||:..||:.|.|....:|   ||      ::
Human   576 NKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFT------IQ 634

  Fly   614 RFYNHVVANDAIL--PFV------------------ISNGPSGAPLSFKFAHRGSAEMLRELSMI 658
            ...||::.|..|:  .|:                  |.:||.|..|...|.:..:.|...|:..:
Human   635 LEANHIIKNSQIMSSKFIIYVVACARVSSLKVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGAL 699

  Fly   659 LRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSG----SAEQLLDNYAL 719
            |.::||.|..|::||||||:.|:|:.:....:|....:...|:|..|..|    :.::||..|..
Human   700 LLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYD 764

  Fly   720 AIK-RPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSN--SLSPEL-RQRMQHLDEKLG 780
            ||| :....||||::|..||:||||:|:||..|||:.:|:|:.|  .|..|| ||...|..:..|
Human   765 AIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRG 829

  Fly   781 PGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIR--GKLPKWISRHI 837
            ...|.::||....:|:||.:||.:||..|:..:.|:|.||.:...|  ..|.||:.:.|
Human   830 LLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQI 888

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 240/967 (25%)
DEXDc2 16..394 CDD:214693 111/453 (25%)
Helicase_C_2 659..836 CDD:290046 70/187 (37%)
BRIP1XP_011523634.1 rad3 245..901 CDD:273169 192/734 (26%)
DEAD_2 248..415 CDD:284209 57/189 (30%)
Helicase_C_2 700..886 CDD:290046 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.