DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and UVH6

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_171818.1 Gene:UVH6 AraportID:AT1G03190 Length:758 Species:Arabidopsis thaliana

Alignment Length:755 Identity:199/756 (26%)
Similarity:322/756 (43%) Gaps:128/756 (17%)


  Fly   149 VHPGKLE---ELEKDLDPESDSDSEHETADGPQEAAED---RYR------PVQIFFCSRTHSQLA 201
            ::|.:.|   ||::.||.:.....|..|..|...|...   .||      |:::.:|:||..::.
plant    17 IYPEQYEYMVELKRALDAKGHCLLEMPTGTGKTIALLSLITSYRLSRPDSPIKLVYCTRTVHEME 81

  Fly   202 QIVAELRKTPHGQSVR---------SISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPN 257
            :.:.|| |..|...||         ::.|.||:.||.|..|     :...|...:|.|.:| |..
plant    82 KTLGEL-KLLHDYQVRHLGTQAKILALGLSSRKNLCVNTKV-----LAAENRDSVDAACRK-RTA 139

  Fly   258 PSKKSRLTAEAN-SRCPF-----KAASLVESLRDLALTEP--LDIEELANEGTACGGCSYYASRS 314
            ...::..|...| ..|.|     |||       :.||..|  ..:|:|...|...|.|.|:.:|.
plant   140 SWVRALSTENPNVELCDFFENYEKAA-------ENALLPPGVYTLEDLRAFGKNRGWCPYFLARH 197

  Fly   315 AVEHAQLILLPYQLLLQKSARNQLGISL-KGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKVQ 378
            .::.|.:|:..||.||.......:...| |.|:|:.|||||:.:...:.....:.|..||.|   
plant   198 MIQFANVIVYSYQYLLDPKVAGFISKELQKESVVVFDEAHNIDNVCIEALSVSVRRVTLEGA--- 259

  Fly   379 ISGYKDHFQKRFTTKNLLKINQIIFIIR------------RLLKILDQRKELQSNGCSMMRT--- 428
                         .:||.||.|.|...:            ||::.|..|.:| |.|...:..   
plant   260 -------------NRNLNKIRQEIDRFKATDAGRLRAEYNRLVEGLALRGDL-SGGDQWLANPAL 310

  Fly   429 -YELTAEGDFFNIDLCELLDFCARTRFARKVQGRADRMEREPRPSENQAPVSTARSLILQRLASE 492
             :::..|....||...|......|    |.:|....|::.|  ..|.::|||...||..|....:
plant   311 PHDILKEAVPGNIRRAEHFVHVLR----RLLQYLGVRLDTE--NVEKESPVSFVSSLNSQAGIEQ 369

  Fly   493 QKLK---EKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSNAEDG 554
            :.||   ::.:|:...:|..:.::..                    ||:.:..|...:.:.|...
plant   370 KTLKFCYDRLQSLMLTLEITDTDEFL--------------------PIQTVCDFATLVGTYARGF 414

  Fly   555 RILVDPVGGTLKYILLDPAEQFA---------DIVAEARAIVIAGGTMQPTKELKEQL--FTGCH 608
            .|:::|....:.:| .||..|.:         .:....:::||..||:.|. :|..:|  ||   
plant   415 SIIIEPYDERMPHI-PDPILQLSCHDASLAIKPVFDRFQSVVITSGTLSPI-DLYPRLLNFT--- 474

  Fly   609 DRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCF 673
             .:|.|.:...:..|.|.|.|::.|....|:|.||..|....::|....:|..:..:||.|||||
plant   475 -PVVSRSFKMSMTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVVRNYGKLLVEMVSIVPDGVVCF 538

  Fly   674 LPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGSAEQ--LLDNYALAIKRPASYGALLLSVVG 736
            ..||.|:|.:.....::|.|:.|..:|.||.|.....|.  .||||..|.  ....||:..||..
plant   539 FVSYSYMDGIIATWNETGILKEIMQQKLVFIETQDVVETTLALDNYRRAC--DCGRGAVFFSVAR 601

  Fly   737 GKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLGPGAGNEYYENLCVKAVNQCIG 801
            ||::||::|....||.|::.|:|:..:||..||.|:::|.:......| ::.....::...||:|
plant   602 GKVAEGIDFDRHYGRLVVMYGVPFQYTLSKILRARLEYLHDTFQIKEG-DFLTFDALRQAAQCVG 665

  Fly   802 RAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEAN 841
            |.:|...||..:...|||::....|.|||.||..|:.:|:
plant   666 RVIRSKADYGMMIFADKRYSRHDKRSKLPGWILSHLRDAH 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 199/754 (26%)
DEXDc2 16..394 CDD:214693 70/275 (25%)
Helicase_C_2 659..836 CDD:290046 62/179 (35%)
UVH6NP_171818.1 rad3 7..714 CDD:273169 199/756 (26%)
DEXDc2 8..280 CDD:214693 76/293 (26%)
HBB 269..413 CDD:284245 32/171 (19%)
HELICc2 542..686 CDD:214694 47/147 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D186062at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.