DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and rtel1

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001013328.2 Gene:rtel1 ZFINID:ZDB-GENE-050306-11 Length:1177 Species:Danio rerio

Alignment Length:892 Identity:228/893 (26%)
Similarity:350/893 (39%) Gaps:207/893 (23%)


  Fly    20 FPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEMLARIRG 84
            ||::||..||..|.::.:.|::...|:.||||||||:|.|.|..|.|....::.:....:....|
Zfish    13 FPFTPYPCQEDYMSKVIECLQKKVNGVLESPTGTGKTLCLLCSTLAWRDHFKDTISARKITERMG 77

  Fly    85 VEQELAKLKEESEQSSNWLESQGKSRAQRAELLRLQHLQALLDKQEQQLDQIRKGAKKHKRQGRV 149
            ..:..|     ....|:|    |.:                                        
Zfish    78 GAELFA-----DRPMSSW----GTA---------------------------------------- 93

  Fly   150 HPGKLEELEKDLDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQ 214
                          .:|.|:.....|.|           :|.:.|||||||.|:|.||:.|.:..
Zfish    94 --------------ATDGDTPTYYTDIP-----------KIIYASRTHSQLTQVVNELKNTSYRP 133

  Fly   215 SVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPFKAASL 279
            .:  ..||||:|||.|..|  ::|                ..|..|.....|:.:||......::
Zfish   134 KI--CVLGSREQLCINQEV--MRH----------------ESNHIKVHMCRAKVSSRSCIFYNNV 178

  Fly   280 VESLRDLALTEP-LDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLK 343
            .|...|..:... ||:|:|...|.....|.||.|||..:||.:|.:||..||...:|....|.||
Zfish   179 DEKSTDKEIVNSILDVEDLVKTGKKQRVCPYYLSRSLKQHADVIFMPYNYLLDPKSRRAHNIELK 243

  Fly   344 GSIVIVDEAHNL-----------------------LDSVAQLHGSEISRQQLERAKVQISGYKDH 385
            |::||.|||||:                       :|.:.:...|:||:.. ......:......
Zfish   244 GAVVIFDEAHNVEKMCEESTSFDLTPHDLISAIEAVDRLLREQASDISKAD-SAEDFNVESLNSG 307

  Fly   386 FQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCA 450
            .:...||  :.|:.||:..:...:...:.....|.          :|..|.|. .:|.|:.:..:
Zfish   308 LKMDITT--IAKVKQILMDLETAINDFEMPANNQG----------ITKPGSFI-FELFEMANVNS 359

  Fly   451 RTRFARKVQGRADRMER-----EPRP-----SENQAPVSTARSLILQRLASEQKLKEKT----KS 501
            :|:     ....:.||:     ..||     :.....|:....|:.....:|...|.:|    |.
Zfish   360 KTK-----TETVEAMEQITGYLAGRPGVFLNTSGLQKVADIIQLVFVAEPAEGSKKSQTGNSLKE 419

  Fly   502 VKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSNAEDGRILVDPVGGTLK 566
            .|..:...|...|           ||.:.:|..|            :|..:.|.:        |.
Zfish   420 FKVHIHPDNSNFK-----------KKQITDVWAS------------SSTKKQGNV--------LS 453

  Fly   567 YILLDPAEQFADIV-AEARAIVIAGGTMQPTKELKEQLFTGCHDRL---VERFYNHVVANDAILP 627
            |....|.....::: .|.|.|::..||:.|...     || |..::   |.....||:..|.|..
Zfish   454 YWCFSPGFSMQELLRQEVRCIILTSGTLSPLSS-----FT-CEMQIPFPVSLENPHVIQRDQIFV 512

  Fly   628 FVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGT 692
            .:|..||.|..||..|..|...|.:..:...|.||.:|||.|::.|.|||..:||..::....|.
Zfish   513 SIIEKGPDGVQLSTAFDRRFVPENMSSMGNTLVNLSRVVPHGLLVFFPSYPVMDKTLEFWRAKGH 577

  Fly   693 LETISGRKSVFREV--SGSAEQLLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLV 755
            .:.|...|.:|.|.  .|:..:::|.|...:..|.|.|....:|..||.||||:|||..||.|::
Zfish   578 ADRIENVKPMFVEPRGKGTFTEVIDGYYGKVDDPNSSGGSFFAVCRGKASEGLDFADTYGRGVVI 642

  Fly   756 VGLPYSNSLSPELRQRMQHLDE----KLGPG----AGNEYYENLCVKAVNQCIGRAVRHIKDYAC 812
            .|||:...:.|.:..:||:|||    |:. |    .|.|:|.....:||||.|||.:||.:||..
Zfish   643 TGLPFPPRMDPRVVLKMQYLDEMCRNKIS-GVKYLTGQEWYRQQASRAVNQAIGRVIRHREDYGA 706

  Fly   813 VYLLDKRFADPKIRGKLPKWISRHIVEANAANGGFGAVQGRTARFFK 859
            ::|.|.||.....|.:||.|:..::    ....|||.:....|:||:
Zfish   707 IFLCDHRFKSADARNQLPSWVRPYV----KIYDGFGTMVRDVAQFFR 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 222/873 (25%)
DEXDc2 16..394 CDD:214693 97/398 (24%)
Helicase_C_2 659..836 CDD:290046 70/187 (37%)
rtel1NP_001013328.2 rad3 13..742 CDD:273169 225/884 (25%)
DEAD_2 111..272 CDD:284209 59/181 (33%)
Nuclear localization signal. {ECO:0000255|HAMAP-Rule:MF_03065} 151..167 4/32 (13%)
DEAH box 250..253 3/3 (100%)
Helicase_C_2 544..730 CDD:290046 70/187 (37%)
Nuclear localization signal. {ECO:0000255|HAMAP-Rule:MF_03065} 883..889
HN_RTEL1 889..987 CDD:259826
HN_RTEL1 1041..1144 CDD:259826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.