DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and ercc2

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001008131.1 Gene:ercc2 XenbaseID:XB-GENE-949792 Length:760 Species:Xenopus tropicalis

Alignment Length:760 Identity:188/761 (25%)
Similarity:316/761 (42%) Gaps:155/761 (20%)


  Fly   156 ELEKDLDPESDSDSEHETADGPQEA------AEDRYRPVQI---FFCSRTHSQLAQIVAELRK-- 209
            ||::.||.:.....|..:..|...:      |..|..|:::   .:||||..::.::|.||||  
 Frog    27 ELKRTLDAKGHGVLEMPSGTGKTVSLLSLIVAYQRAYPLEVTKLIYCSRTVPEIEKVVEELRKLI 91

  Fly   210 ------TPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSR-LTAE 267
                  |....:..:::|.||:.||.||.|..|:....::.||..:.....|   |:|.| .|.:
 Frog    92 EYTQAQTGGTLNFMALALSSRRNLCVNPEVSALRFGKEIDGRCHSLTASFVR---SQKQRDPTVQ 153

  Fly   268 ANSRCPFKAASLVESLRDLALTEPL-----DIEELANEGTACGGCSYYASRSAVEHAQLILLPYQ 327
            .   |.|     .|....:....||     ::::|...|...|.|.||.:|.|:....:::..|.
 Frog   154 T---CRF-----FEEFDAIGRETPLPPGIYNLDDLRTLGRQKGWCPYYLARHALGQCNVVVYSYH 210

  Fly   328 LLLQKSARNQLGISL-KGSIVIVDEAHNL----LDSVAQLHGSEISRQQLERAKVQISGYKDHFQ 387
            .||.....:.:...| |.|:|:.|||||:    :||::    ..|:|:.|||.:..|.......:
 Frog   211 YLLDPKIADLVSRELSKKSVVVFDEAHNIDNVCIDSMS----VTITRRTLERCQTNIETLNTAIE 271

  Fly   388 KRFTTKNLLKINQIIFIIRRLLKILDQR--KELQSNGCSMMRTYELTAEGDFFNID-------LC 443
            |                    :|..|::  ||..:.....:|...:..|.|.:..:       |.
 Frog   272 K--------------------IKETDEKKLKEEYAQLVEGLREASVARETDVYLSNPVLPDEILQ 316

  Fly   444 ELLDFCARTR-----FARKVQG------RADRMEREPRPSENQAPVSTARSLILQRLASEQK--- 494
            |.:..|.|..     |.|::.|      ||..:.:|       .|.:..|.| .:::..|:|   
 Frog   317 EAVPGCIRNALHFLGFLRRLVGYIKSRLRAGHVTQE-------GPAAFLRDL-YEKVCIERKPMR 373

  Fly   495 -LKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSNAEDGRILV 558
             ..|:.:|:.|.:|..:..|.                    ||:..:..|...:::..:...|::
 Frog   374 FCAERLRSLTRTLEIADITDL--------------------SPLTLITNFATLVSTYTKGFMIII 418

  Fly   559 DPV--------GGTLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVE-- 613
            :|.        ...|.:..||.:.....:....::::|..||:.|         ...:.::::  
 Frog   419 EPFEDRTPSISNPVLHFSCLDSSLAIKPVFQRFQSVIITSGTLSP---------LDIYPKILDFR 474

  Fly   614 ----RFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFL 674
                ..:...:|...:.|.|:..|.....:|.||..|....::|....:|..:..|||.|:|.|.
 Frog   475 PVTMATFTMTLARVCLCPMVVGRGNDQVAMSSKFETREDLAVMRNYGNLLLEMSAVVPDGIVGFF 539

  Fly   675 PSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGSAEQ--LLDNYALAIKRPASYGALLLSVVGG 737
            .||.|::.:.....:.|.||.|...|.:|.|....||.  .|:.|..|.:.  ..||:||||..|
 Frog   540 TSYLYMENIVASWYEQGILENIQRNKLIFIETQDGAETSVALEKYQEACEN--GRGAILLSVARG 602

  Fly   738 KLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQ------HLDEKLGPGAGNEYYENLCVKAV 796
            |:|||::|....||||::.|:||..:.|..|:.|:|      ||.|       |::.....::..
 Frog   603 KVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLQFLRDQFHLRE-------NDFLTFDAMRHA 660

  Fly   797 NQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEAN 841
            .||:|||:|...||..:...|||:|....|||||.||..|:.:||
 Frog   661 AQCVGRAIRGKTDYGIMLFADKRYARSDKRGKLPLWIQEHLTDAN 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 187/759 (25%)
DEXDc2 16..394 CDD:214693 69/266 (26%)
Helicase_C_2 659..836 CDD:290046 68/185 (37%)
ercc2NP_001008131.1 rad3 7..708 CDD:273169 188/761 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.