DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and Y54G2A.50

DIOPT Version :10

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001380098.1 Gene:Y54G2A.50 / 3896807 WormBaseID:WBGene00044493 Length:152 Species:Caenorhabditis elegans


Alignment Length:65 Identity:17/65 - (26%)
Similarity:30/65 - (46%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 SNAEDGRILVDPVG-GTLKYILLDPAEQFADIVAEARAIVIAGGTMQP--TKELKEQLFTGCHDR 610
            |.:|.|...:...| .|:....:.||..|.|...:.|:||:|  |:.|  ..:|.::....|.::
 Worm    43 SISETGHKPISECGKTTIGLWCMSPALSFFDAFNKTRSIVLA--TLLPMARTDLNDKKRAWCSNK 105

  Fly   611  610
             Worm   106  105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DEAD-like_helicase_N 42..>101 CDD:475120
rad3 187..837 CDD:273169 17/65 (26%)
Y54G2A.50NP_001380098.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.