DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and Ddx11

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001335221.1 Gene:Ddx11 MGIID:2443590 Length:906 Species:Mus musculus

Alignment Length:932 Identity:350/933 (38%)
Similarity:505/933 (54%) Gaps:129/933 (14%)


  Fly     7 NQRLDTPGAQEFGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHE 71
            ||.:   |...|.||:.||.||:..|.||::|||.|::|||||||||||||:|.||||:||...|
Mouse     5 NQEI---GGIHFPFPFPPYPIQKDFMAELYKVLEGGKIGIFESPTGTGKSLSLICGALSWLRDFE 66

  Fly    72 -ELVRTEMLARIRG----VEQELAKLKEESEQ----------SSNWLESQGKSRAQRAELLRLQH 121
             :.::.|.|....|    ..::.:.|...|.|          ..:|:....:.:.:|..:.||:.
Mouse    67 KKKLQAEALLLAPGSGPPSSEKNSLLTSSSCQEPTDTPRPAGEPDWVTEFVQKKEERDLVERLRE 131

  Fly   122 LQALLDKQEQQLDQI------RKGAKKHKRQ----------------GRVHPGKLEELEKD---- 160
            .|....|:|::|.::      |..||:.|.:                ....|.:||:||..    
Mouse   132 EQVRRRKREERLKEVCQDGRLRFAAKRTKHEEEETEALLRLSREMLDAGTGPEQLEQLECGEEHL 196

  Fly   161 --LDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQSVRSISLGS 223
              .:.|||.:......|..::..|:.: ..:|::||||||||||.|.|:.|:|.|:..|.:||||
Mouse   197 VLAEYESDEERRGSRVDEAEDDLEEEH-ITKIYYCSRTHSQLAQFVREVLKSPFGKETRLVSLGS 260

  Fly   224 RQQLCGNPAVRKLKHVGLMNERCLDMATKKARPN---PSKKSRLTAEANSRCPFKAASLVESLRD 285
            ||.||.|..|:.|..|.|||:||:||...|...|   ..|..|...:..:.|||.....:|.|||
Mouse   261 RQTLCVNEDVKNLGSVQLMNDRCVDMQRSKREKNGTGEDKPKRKRQKIQTSCPFYNHEQMELLRD 325

  Fly   286 LALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVD 350
            ..|.|..|:|:|...|.....|.||.||.|:..|||::|||.:||..:.|...||.|:|.:||:|
Mouse   326 EILLEVKDMEQLVALGKEARACPYYGSRFAIPAAQLVVLPYPMLLHAATRQAAGIRLQGQVVIID 390

  Fly   351 EAHNLLDSVAQLHGSEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQR 415
            |||||:|::..:|.:|::..||.:|..|:..|.:.::||...|||:.|.||::::.:.:.:|...
Mouse   391 EAHNLIDTITNIHSTEVNGSQLCQAHSQLLQYMERYRKRLKAKNLMYIKQILYLLEKFVAVLGGN 455

  Fly   416 KELQSNGCSMMRT-YELTAEGDFF------NIDLCELLDFCARTRFARKVQGRADRMEREPRPSE 473
            .:......|:.:| .||.:..||.      ||:|.::..:..::..:||:.|             
Mouse   456 VKQNPTTQSLSQTGSELKSINDFLFQSQVDNINLFKVQRYLEKSMLSRKLFG------------- 507

  Fly   474 NQAPVSTARSLILQRLASEQK------LKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEE- 531
                .:....::|..|:..|:      .::..||:                  |..||:...|| 
Mouse   508 ----FTECFGVVLPSLSDSQENRGLAGFQQFLKSL------------------QSGPTEDSPEEG 550

  Fly   532 --VAPSPIRPLL---AFLETLTSNAEDGRILVDPVG----GTLKYILLDPAEQFADIVAEARAIV 587
              ||..|..||:   |||..||:..:|||::|:..|    .:||::||:||..||.:|.|.||:|
Mouse   551 QAVALRPASPLMHIEAFLAALTTANQDGRVIVNRQGSVGQSSLKFLLLNPAVHFAQVVKECRAVV 615

  Fly   588 IAGGTMQPTKELKEQLFTGCH----DRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGS 648
            ||||||||..:.:|||. .|.    .|:||....||:..|.|||.:|.:|||...|.|.:..|..
Mouse   616 IAGGTMQPMSDFREQLL-ACSGVEAGRVVEFSCGHVIPPDNILPLIICSGPSNQQLEFTYQRREL 679

  Fly   649 AEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREV--SGSAE 711
            .:|:.|...||.|||.||||||||||||||||.:|:.:.:::|.|..:|.||.:|:|.  :...|
Mouse   680 PQMVEETGRILCNLCNVVPGGVVCFLPSYEYLRQVHAHWDKTGLLTRLSVRKKIFQEPKRASQVE 744

  Fly   712 QLLDNYALAIKRPASY------GALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQ 770
            |:|..|:..| ...|:      |||||||||||:|||:||:|||||.|::||:||.|..||||::
Mouse   745 QVLMAYSKCI-MSCSHSEGHLTGALLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQE 808

  Fly   771 RMQHLDEKL-----GPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLP 830
            :|.:|::.|     .|..|....||||:||:||.||||:||.:|:|.:.|||.|:|.|.|..|||
Mouse   809 KMAYLNQTLPRTQGQPLPGTVLIENLCMKAINQSIGRAIRHQRDFASIVLLDHRYARPSILAKLP 873

  Fly   831 KWISRHIVEANAANG-GFGAVQ 851
            .|| |..||..|..| .|.||:
Mouse   874 AWI-RDRVEVKATFGPAFAAVR 894

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 342/912 (38%)
DEXDc2 16..394 CDD:214693 154/424 (36%)
Helicase_C_2 659..836 CDD:290046 99/190 (52%)
Ddx11NP_001335221.1 HBB 225..889 CDD:331768 281/702 (40%)
DEAH box. {ECO:0000255|PROSITE-ProRule:PRU00541} 390..393 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53799622
eggNOG 1 0.900 E1_COG1199
Hieranoid 1 1.000
Homologene 1 1.000 H68973
Inparanoid 1 1.050 525 1.000 Inparanoid score I1230
Isobase 1 0.950 0 Normalized mean entropy S1862
OMA 1 1.010
OrthoDB 1 1.010 D141017at33208
OrthoFinder 1 1.000 FOG0004084
OrthoInspector 1 1.000 T1085703
orthoMCL 1 0.900 OOG5_127999
Panther 1 1.100 LDO PTHR11472
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R199
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.