DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and Ddx11

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_017443925.1 Gene:Ddx11 RGDID:1306675 Length:888 Species:Rattus norvegicus

Alignment Length:908 Identity:340/909 (37%)
Similarity:497/909 (55%) Gaps:110/909 (12%)


  Fly    14 GAQEFGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEE---LVR 75
            |...|.||:.||.||:..|.||::|||.|::|||||||||||||:|.||||:||...|:   ...
  Rat     9 GGIHFPFPFPPYPIQKDFMAELYKVLEAGKIGIFESPTGTGKSLSLICGALSWLRDFEQKKLQAE 73

  Fly    76 TEMLARIRGVEQ-------ELAKLKEESEQ-----SSNWLESQGKSRAQRAELLRLQHLQALLDK 128
            ..:||...|...       ..:..:|.|:.     ..:|:....:.:.:|..:.||:..|....|
  Rat    74 AGLLAPASGPTSSGRNSVLSSSSCQEPSDTLRPAGDPDWVTEFVQKKEERDLVERLREEQLRRRK 138

  Fly   129 QEQQLDQIRKGAKKH---KRQ---------GRVHPGKLEELEKD-----LDP----ESDSDSEHE 172
            :|::|.::.:..::.   ||.         |::|.........|     |.|    .|:|.....
  Rat   139 REERLQEVCQDGRRRFAAKRSVSTWRAVGCGQLHTAWARRETPDWQTPLLLPLATISSNSGWGFL 203

  Fly   173 TADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQSVRSISLGSRQQLCGNPAVRKLK 237
            ::.|            ||::||||||||||.|.|::|:|.|:..|.:||||||.||.|..|:.|.
  Rat   204 SSSG------------QIYYCSRTHSQLAQFVREVQKSPFGKETRLVSLGSRQSLCVNEDVKSLG 256

  Fly   238 HVGLMNERCLDMAT---KKARPNPSKKSRLTAEANSRCPFKAASLVESLRDLALTEPLDIEELAN 299
            .|.|||:||:||..   ||.|....|..|...:..:.|||.....:|.|||..|.|..|:|:|..
  Rat   257 SVHLMNDRCVDMQRRKHKKMRIGEDKPKRRRQKMQASCPFYNHEQMELLRDEILLEVKDMEQLVA 321

  Fly   300 EGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVDEAHNLLDSVAQLHG 364
            .|.....|.||.||.|:..|||::|||.:||..:.|...||.|:|.:||:||||||:|::..:|.
  Rat   322 LGKEAQACPYYGSRFAIPAAQLVVLPYPMLLHAATRQAAGIRLQGQVVIIDEAHNLIDTITNIHS 386

  Fly   365 SEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRT- 428
            :|::..||.:|..|:..|.:.::||...|||:.|.||::::.:.:.:|....:...:..|:.:| 
  Rat   387 TEVNGSQLCQAHSQLLQYMERYRKRLKAKNLMYIKQILYLLDKFVAVLGGNVKQNPSTQSLPQTG 451

  Fly   429 YELTAEGDFF------NIDLCELLDFCARTRFARKVQGRADRMEREPRPSENQAPVSTARSLILQ 487
            .||.:..||.      ||:|.::..:..::..:||:.|                 .:....::|.
  Rat   452 SELQSINDFLFQSQVDNINLFKVQRYLEKSMLSRKLFG-----------------FTECFGVVLP 499

  Fly   488 RLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSNAE 552
            .| |:.:........::.::.:......:.|:|.|....:|.     ||:..:.||||.||:..:
  Rat   500 SL-SDSEENRGLGGFQQFLKSLQSGPPEDSLEEGQAVALRPA-----SPLMHIEAFLEALTTANQ 558

  Fly   553 DGRILVDPVG----GTLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCH----D 609
            |||::|:..|    .:||::||:||..||.:|.|.||:|||||||||..:.:|||. .|.    .
  Rat   559 DGRVIVNRQGSVGQSSLKFLLLNPAVHFAQVVKECRALVIAGGTMQPVSDFREQLL-ACSGVEAS 622

  Fly   610 RLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFL 674
            |:||....||:..|.|||.:|.:|||...|.|.:..|...:|:.|...||.|||.|||||:||||
  Rat   623 RVVEFSCGHVIPPDNILPLIICSGPSNQQLEFTYQRRELPQMMEETGRILCNLCNVVPGGMVCFL 687

  Fly   675 PSYEYLDKVYKYLEQSGTLETISGRKSVFREV--SGSAEQLLDNYALAIKRPAS--------YGA 729
            ||||||.:|:.:.:::|.|..:|.||.:|:|.  :...||:|..|:..|   ||        .||
  Rat   688 PSYEYLRQVHAHWDKTGLLARLSVRKKIFQEPKRASQVEQVLTAYSTCI---ASCSHSEGHLTGA 749

  Fly   730 LLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKL-----GPGAGNEYYE 789
            |||||||||:|||:||:|||||.|::||:||.|..||||:::|.:||:.:     .|..|....|
  Rat   750 LLLSVVGGKMSEGINFSDDLGRCVVMVGMPYPNIKSPELQEKMAYLDQTIPRTHGQPPPGTVLIE 814

  Fly   790 NLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEANAANG-GFGAVQ 851
            |||:||:||.||||:||.||:|.:.|||.|:|.|.|..|||.|| |..||..|..| .|.|::
  Rat   815 NLCMKAINQSIGRAIRHQKDFASIVLLDHRYARPSILAKLPAWI-RDRVEVKATFGPAFAAMR 876

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 335/895 (37%)
DEXDc2 16..394 CDD:214693 151/417 (36%)
Helicase_C_2 659..836 CDD:290046 100/192 (52%)
Ddx11XP_017443925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53785967
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68973
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D141017at33208
OrthoFinder 1 1.000 FOG0004084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11472
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.