DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and AT2G05635

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001318203.1 Gene:AT2G05635 AraportID:AT2G05635 Length:146 Species:Arabidopsis thaliana

Alignment Length:95 Identity:26/96 (27%)
Similarity:45/96 (47%) Gaps:14/96 (15%)


  Fly   124 ALLDKQEQQLDQIRKGAKKHKR---QGRVHP-----GKLEELEKDLDPESDSDSEHETADGPQEA 180
            ::|..|:....::.||...|.:   :....|     |.:.|.::...|.|.:..:.||      |
plant    29 SVLAWQQNYKSRLLKGNLTHSKAAPEAATDPLNHGGGFIPETQQRDTPASINVEKAET------A 87

  Fly   181 AEDRYRPVQIFFCSRTHSQLAQIVAELRKT 210
            .:.|.:...|::.||||||:.|::.|.|||
plant    88 TKKRTKIPTIYYASRTHSQITQVIREYRKT 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 26/96 (27%)
DEXDc2 16..394 CDD:214693 26/96 (27%)
Helicase_C_2 659..836 CDD:290046
AT2G05635NP_001318203.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D186062at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11472
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.