DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and AT2G05635

DIOPT Version :9

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_973426.1 Gene:AT2G05635 / 2745433 AraportID:AT2G05635 Length:146 Species:Arabidopsis thaliana


Alignment Length:138 Identity:37/138 - (26%)
Similarity:58/138 - (42%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TEMLARIRGVEQELAKLKEESEQSSN---WLESQGKSRAQRAELLRLQHLQALLDKQEQQLDQIR 137
            ||:|.:|     ||....:....|.:   |.::. |||..:.   .|.|.:|   ..|...|.:.
plant     9 TEILMKI-----ELFTAYQSFNTSCSVLAWQQNY-KSRLLKG---NLTHSKA---APEAATDPLN 61

  Fly   138 KGAKKHKRQGRVHPGKLEELEKDLDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQ 202
            .|.           |.:.|.::...|.|.:..:.||      |.:.|.:...|::.||||||:.|
plant    62 HGG-----------GFIPETQQRDTPASINVEKAET------ATKKRTKIPTIYYASRTHSQITQ 109

  Fly   203 IVAELRKT 210
            ::.|.|||
plant   110 VIREYRKT 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DEAD-like_helicase_N 42..>101 CDD:475120 7/24 (29%)
rad3 187..837 CDD:273169 12/24 (50%)
AT2G05635NP_973426.1 DEAD-like_helicase_N 28..>127 CDD:475120 30/114 (26%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.