DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and chl1

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_594977.1 Gene:chl1 PomBaseID:SPAC3G6.11 Length:844 Species:Schizosaccharomyces pombe

Alignment Length:938 Identity:292/939 (31%)
Similarity:456/939 (49%) Gaps:204/939 (22%)


  Fly    18 FGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEMLARI 82
            |..||:||:||.:.|:.|:..:..|::|||||||||||||:|.|.:||||..|            
pombe    13 FHHPYTPYDIQLEFMRSLYSSISDGKIGIFESPTGTGKSLSLICASLTWLDEH------------ 65

  Fly    83 RGVEQELAKLKEESEQSS-----------NWLESQGKSRAQRAELLRLQHLQALLDKQEQQLDQI 136
            .||      |.|::|:|:           :|:..| ..:.|: :|::..|.     :.||:|::|
pombe    66 GGV------LLEDNEKSNDNKSNTSSKIPDWVLEQ-DLKIQK-DLVKETHA-----RLEQRLEEI 117

  Fly   137 RKGAKKHKRQ-----GRVHPGKLEELEKDLDPE---SDSDSEHETADGP---------------Q 178
            ||..:..|.|     ...|   .|...::::.|   ||:.:...|:..|               .
pombe   118 RKRNQSRKNQMSNNSTTYH---RETKRRNINAEASTSDNCNNSNTSVDPMDEYLVTAEYTMPSTS 179

  Fly   179 EAAEDRYR---------------------PV--QIFFCSRTHSQLAQIVAELRK-------TPHG 213
            |.:||.:.                     |:  :|:|.|||||||.|:|.|::|       ||  
pombe   180 EQSEDLFNNGYSSKVSELLRKLSPDNEKPPIVQKIYFTSRTHSQLQQLVQEIKKLNNQTFSTP-- 242

  Fly   214 QSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPF-KAA 277
              :|.:||.||:.||.|..||||:....:||:|::               |...|: :||| :..
pombe   243 --IRVVSLASRKNLCINNEVRKLRPTSALNEKCIE---------------LQGSAH-KCPFLQDN 289

  Fly   278 SLVESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISL 342
            :.:...||.||.|.:|||||...|.....|.||.:|.||:.||::.|||.||||:||||.|.::|
pombe   290 TQLWDFRDEALAEIMDIEELVELGQRLKVCPYYGTREAVDSAQIVTLPYPLLLQESARNALNLTL 354

  Fly   343 KGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRR 407
            |.:|.|:||||||:|::..:|.|.||.:|:..|:.|:..|...|:||....|.:.|.|:|.::..
pombe   355 KDNICIIDEAHNLIDAICSMHSSSISFRQVCIAETQLQQYFLRFEKRLNGNNRMHIKQLIKVVYN 419

  Fly   408 L-------------LKILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCARTRFARKVQ 459
            |             .|:::....|.|||...:..:.|:   ::.|:           ::.||||.
pombe   420 LKSFFLNCLETNTNSKVINVDSLLVSNGADQINLHHLS---EYLNV-----------SKLARKVD 470

  Fly   460 GRADRMEREPRPSENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDINKEDKAEELQEQQKP 524
            |....|                .||..|.|.|...|         |.|..:..:..||       
pombe   471 GYTKYM----------------HSLGTQELESLNDL---------RSERFSNGNGYEE------- 503

  Fly   525 TKKPVEEVAPSPIRPLL----AFLETLTSNAEDGRILVDPVGGT---LKYILLDPAEQFADIVAE 582
                      .|..|:|    :||..:.:.|.:|::..:...|.   |||:||||::....:..:
pombe   504 ----------DPYTPVLMQLESFLLNIANPAPEGKLFYEKQTGDNPYLKYLLLDPSKHVEILTEQ 558

  Fly   583 ARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRG 647
            .|::.:|||||.|..:....||:....|::....:|:|..:.|...::|.||:|.|..|....:.
pombe   559 CRSVNLAGGTMSPIDDFITLLFSDEQSRILPFSCDHIVPPENITTILVSQGPAGVPFEFTHKRKD 623

  Fly   648 SAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGSAEQ 712
            ...:|::|....:|...::|.|||.|.||:.:|.:..|..|.:|....::.:|.:|.|.....:.
pombe   624 DENLLKDLGRTFQNFISIIPDGVVVFFPSFAFLQQAVKVWEMNGITNRLNAKKPLFIESKDFGDN 688

  Fly   713 LLD---NYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQH 774
            .||   :|..::  .|....:|.||:||:||||:||:|.|||||:|||:|:.||...|.:.::.:
pombe   689 PLDTFEHYKQSV--DAGLSGMLFSVIGGRLSEGINFSDKLGRAVMVVGMPFPNSQDVEWQAKVSY 751

  Fly   775 LDEKL------GPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWI 833
            ::||.      ...|..|:|||.|::||||.||||:||..|||.:.|||.|:....|:.|||.|:
pombe   752 VEEKAKEKGINAKQASQEFYENTCMRAVNQSIGRAIRHRDDYASIILLDSRYNRSSIQRKLPNWL 816

  Fly   834 SRHIVEANAANGGFGAVQGRTARFFKGR 861
            |::|    .::..||....:.|.||:.:
pombe   817 SKNI----HSSPNFGPAIRQLATFFRAK 840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 287/917 (31%)
DEXDc2 16..394 CDD:214693 148/441 (34%)
Helicase_C_2 659..836 CDD:290046 74/186 (40%)
chl1NP_594977.1 DEXDc2 11..407 CDD:214693 149/442 (34%)
rad3 131..833 CDD:273169 240/787 (30%)
Helicase_C_2 636..819 CDD:290046 74/185 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68973
Inparanoid 1 1.050 402 1.000 Inparanoid score I372
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004084
OrthoInspector 1 1.000 T1126006
orthoMCL 1 0.900 OOG5_127999
Panther 1 1.100 LDO PTHR11472
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R199
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.