DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and ERCC2

DIOPT Version :8

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_000391.1 Gene:ERCC2 / 2068 HGNCID:3434 Length:760 Species:Homo sapiens

Alignment Length:746 Identity:179/747 (24%)
Similarity:318/747 (43%) Gaps:123/747 (16%)


  Fly   154 LEELEKDLDPESDSDSEHETADGPQEA------AEDRYRPVQI---FFCSRTHSQLAQIVAELRK 209
            :.||::.||.:.....|..:..|...:      |..|..|:::   .:||||..::.:::.||||
Human    25 MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRK 89

  Fly   210 ------TPHGQSV--RSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTA 266
                  ...|:.:  ..::|.||:.||.:|.|..|:....::.:|..:.....|......:.|  
Human    90 LLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSL-- 152

  Fly   267 EANSRCPFKAASLVESL----RDLALTEPL-DIEELANEGTACGGCSYYASRSAVEHAQLILLPY 326
               ..|.|     .|..    |::.|...: ::::|...|...|.|.|:.:|.::.||.:::..|
Human   153 ---PHCRF-----YEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSY 209

  Fly   327 QLLLQKSARNQLGISL-KGSIVIVDEAHNL----LDSVAQLHGSEISRQQLERAKVQISGYKDHF 386
            ..||.....:.:...| :.::|:.|||||:    :||::    ..::|:.|:|.:    |..:..
Human   210 HYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMS----VNLTRRTLDRCQ----GNLETL 266

  Fly   387 QKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCAR 451
            ||.              ::|  :|..|:::        :...|....||         |.:..| 
Human   267 QKT--------------VLR--IKETDEQR--------LRDEYRRLVEG---------LREASA- 297

  Fly   452 TRFARKVQGR------ADRMEREPRPSENQAPVSTARSLI--LQRLASEQKLKEKTKSVKRRVED 508
               ||:....      .|.:.:|..|..    :.||...:  |:||....|.:.:.:.|.:....
Human   298 ---ARETDAHLANPVLPDEVLQEAVPGS----IRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPP 355

  Fly   509 INKEDKAEELQEQQKPTKKPVEEVAP-------------SPIRPLLAFLETLTSNAEDGRILVDP 560
            ......|:.:..|:||.:...|.:..             ||:..|..|...:::.|:...|:::|
Human   356 AFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP 420

  Fly   561 --------VGGTLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYN 617
                    ....|.:..:|.:.....:....::::|..||:.|.....:.|  ..|...:..| .
Human   421 FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKIL--DFHPVTMATF-T 482

  Fly   618 HVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDK 682
            ..:|...:.|.:|..|.....:|.||..|....::|....:|..:..|||.|:|.|..||:|::.
Human   483 MTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMES 547

  Fly   683 VYKYLEQSGTLETISGRKSVFREVSGSAEQ--LLDNYALAIKRPASYGALLLSVVGGKLSEGLNF 745
            ......:.|.||.|...|.:|.|....||.  .|:.|..|.:.  ..||:||||..||:|||::|
Human   548 TVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACEN--GRGAILLSVARGKVSEGIDF 610

  Fly   746 ADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDY 810
            ....||||::.|:||..:.|..|:.|:::|.::. ....|::.....::...||:|||:|...||
Human   611 VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQF-QIRENDFLTFDAMRHAAQCVGRAIRGKTDY 674

  Fly   811 ACVYLLDKRFADPKIRGKLPKWISRHIVEAN 841
            ..:...|||||....|||||:||..|:.:||
Human   675 GLMVFADKRFARGDKRGKLPRWIQEHLTDAN 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 178/745 (24%)
DEXDc2 16..394 CDD:214693 60/267 (22%)
Helicase_C_2 659..836 CDD:290046 66/179 (37%)
ERCC2NP_000391.1 rad3 7..708 CDD:273169 179/747 (24%)
DEAH box 234..237 3/3 (100%)
Mediates interaction with MMS19 438..637 61/204 (30%)
Nuclear localization signal. {ECO:0000255} 682..695 9/13 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.