DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and rtel-1

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_492769.1 Gene:rtel-1 WormBaseID:WBGene00009124 Length:994 Species:Caenorhabditis elegans

Alignment Length:909 Identity:223/910 (25%)
Similarity:371/910 (41%) Gaps:229/910 (25%)


  Fly    20 FPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEMLARIRG 84
            ||:.|||.|...|:.:..||:|......||||||||:|:|.|..|.|:.|.:|   |:.|     
 Worm    21 FPFEPYECQRIFMKNVVDVLDRKLDAALESPTGTGKTLSLLCSTLAWVQRQKE---TKPL----- 77

  Fly    85 VEQELAKLKEESEQSSNWLESQGKSRAQRAELLRLQHLQALLDKQEQQLDQIRKGAKKHKRQGRV 149
                         ..:.| ::.|...|::.:                                  
 Worm    78 -------------DFATW-QTSGAGGAEKTD---------------------------------- 94

  Fly   150 HPGKLEELEKDLDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQ 214
                                         |..:..|.|. ||:.|||||||.|:|.||.:|.: :
 Worm    95 -----------------------------EKLKSAYVPT-IFYASRTHSQLEQVVHELNRTEY-K 128

  Fly   215 SVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPFKAASL 279
            .|::..||||:..|.|..|:|:|........|..:.:|:|....:|             |.|.:.
 Worm   129 WVKTTILGSREHFCINQKVKKIKESNRQAHVCRGLVSKRACHYYNK-------------FDACTT 180

  Fly   280 VESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKG 344
            .:....|...|.:|||:....||....|.|:.||...|.|:||||||..::....|.:..:.||.
 Worm   181 DKMTEFLDKGEAMDIEDFVKLGTQNSLCPYFMSRQRSETAELILLPYNYIIDPKMRRRYKLDLKN 245

  Fly   345 SIVIVDEAHNLLDSVAQLHGS-------------EISR------QQLERAKVQISGYKDHF--QK 388
            ||||.||||| |:|:.:.:.|             |:.:      .:.|.|:.:.......|  .|
 Worm   246 SIVIFDEAHN-LESICESNASAELTSTSIALCIEELKKVLALLVDEEETARSEADAETGAFGSAK 309

  Fly   389 RFTTKNL---LKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYE----LTAEGDFFNIDLCELL 446
            ...||.|   |:...::.::.::..:.::..:|  .|.|.:::..    ..::|:.       ||
 Worm   310 IDLTKKLIENLRTEDLMTVLEKIFSLEEEMDKL--FGSSQLKSVPPLSGKASDGEI-------LL 365

  Fly   447 DFCARTRFARKVQGRADRMEREPRPSENQAPVSTARSLILQRLASEQK--LKEKTKSVKR----- 504
            :..|:..|      .|:.:||         .|...|..|...|:..::  |.||...:::     
 Worm   366 ETLAKAGF------DANSVER---------LVDVLRDAISYLLSKNEEVALTEKGDGMEKVADFL 415

  Fly   505 -RVEDINKEDKAEELQEQQKPTKKPVEEVAPSPI-RPLLAFLETLTSNAEDGRILVDPVGGTLKY 567
             .:...:.:|.|..:.|:   |.|.|:.|.|..: |....:::    ..:|...|      |:||
 Worm   416 LSIYSTHAQDVAAAVGEE---TVKLVDRVDPKTVARNCKLYIQ----KDKDNEKL------TIKY 467

  Fly   568 ILLDPAEQFADI-VAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYN------------HV 619
            .....:.....: :...|.:::|.||:.|.     |.||          ||            |.
 Worm   468 FCFQASISMRMLKMRGVRNVLLASGTLSPI-----QAFT----------YNMGLNFGAILENEHA 517

  Fly   620 VANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLD--- 681
            :....:|..:::.|..|. |:..|.:|.:.:.:..::..|..:.:|:|.|::.|..||..:|   
 Worm   518 LKQVPVLTSIVTRGKRGG-LAGSFQNRKNLDYVTGVAEALLRVMEVIPQGILIFFSSYSQMDELV 581

  Fly   682 ---KVYKYLEQSGT--LETISGRKSVFREVSGSAEQLLDNYALAIKRPAS--YGALLLSVVGGKL 739
               |..|:...|..  .|.:...|.|.  |...|::.|....|...:..|  :||.||:|..||:
 Worm   582 ATWKTTKWSSNSNESFWEKMEKTKRVV--VEPRAKEELAAIRLRYTQGVSEQHGAALLAVCRGKV 644

  Fly   740 SEGLNFADDLGRAVLVVGLPYSNSLSPELRQRMQHLDEKLG-------PGAGNEYYENLCVKAVN 797
            |||::|.|...|||:::|:||.......:..:..:||:.:|       ..:..::|:....:|||
 Worm   645 SEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVN 709

  Fly   798 QCIGRAVRHIKDYACVYLLDKRFADPKIRGKLPKWISRHIVEANAANGGFGAVQGRTARFFKGR 861
            |.|||.:||..|:..|.|:|.|:|..|.. ..|||: |:.:..:..:|    ...:|:||||.|
 Worm   710 QAIGRVLRHKDDFGTVVLMDTRYASAKPE-MFPKWL-RNTISRSDTDG----CALKTSRFFKER 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 216/888 (24%)
DEXDc2 16..394 CDD:214693 104/395 (26%)
Helicase_C_2 659..836 CDD:290046 61/194 (31%)
rtel-1NP_492769.1 rad3 16..761 CDD:273169 218/902 (24%)
DEXDc2 17..293 CDD:214693 99/373 (27%)
Helicase_C_2 556..747 CDD:290046 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.