DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11403 and Ercc2

Sequence 1:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_031975.2 Gene:Ercc2 MGIID:95413 Length:760 Species:Mus musculus

Alignment Length:740 Identity:177/741 (24%)
Similarity:316/741 (43%) Gaps:115/741 (16%)


  Fly   156 ELEKDLDPESDSDSEHETADGPQEA------AEDRYRPVQI---FFCSRTHSQLAQIVAELRK-- 209
            ||::.||.:.....|..:..|...:      |..|..|:::   .:||||..::.:::.||||  
Mouse    27 ELKRTLDAKGHGVLEMPSGTGKTVSLLALIVAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLL 91

  Fly   210 ----TPHGQSV--RSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEA 268
                ...|:.:  ..::|.||:.||.:|.|..|:....::.:|..:.....|....:.:.|    
Mouse    92 SFYEQQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQQDASL---- 152

  Fly   269 NSRCPFKAASLVESLRDLALTEPL-DIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQK 332
             ..|.|.....:.. |.:.|...: ::::|...|...|.|.|:.:|.::.||.:::..|..||..
Mouse   153 -PHCRFYEEFDIHG-RQMPLPAGIYNLDDLKALGQRQGWCPYFLARYSILHANVVVYSYHYLLDP 215

  Fly   333 SARNQLGISL-KGSIVIVDEAHNL----LDSVAQLHGSEISRQQLERAKVQISGYKDHFQKRFTT 392
            ...:.:...| :.::|:.|||||:    :||::    ..::|:.|:|.:..:    |..||.   
Mouse   216 KIADLVSKELARKAVVVFDEAHNIDNVCIDSMS----VNLTRRTLDRCQSNL----DTLQKT--- 269

  Fly   393 KNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCARTRFARK 457
                       ::|  :|..|:::        :...|....||             ......||:
Mouse   270 -----------VLR--IKETDEQR--------LRDEYRRLVEG-------------LREASVARE 300

  Fly   458 VQGR------ADRMEREPRPSENQAPVSTARSLI--LQRLASEQKLKEKTKSVKRRVEDINKEDK 514
            ....      .|.:.:|..|..    :.||...:  |:||....|.:.:.:.|.:..........
Mouse   301 TDAHLANPVLPDEVLQEAVPGS----IRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGL 361

  Fly   515 AEELQEQQKPTKKPVE---------EVAP----SPIRPLLAFLETLTSNAEDGRILVDP------ 560
            |:.:..|:||.:...|         |:|.    ||:..|..|...:::.|:...|:::|      
Mouse   362 AQRVCIQRKPLRFCAERLRSLLHTLEIADLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTP 426

  Fly   561 --VGGTLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVAND 623
              ....|.:..:|.:.....:....::::|..||:.|.....:.|  ..|...:..| ...:|..
Mouse   427 TIANPVLHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKIL--DFHPVTMATF-TMTLARV 488

  Fly   624 AILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLE 688
            .:.|.:|..|.....:|.||..|....::|....:|..:..|||.|:|.|..||:|::.......
Mouse   489 CLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWY 553

  Fly   689 QSGTLETISGRKSVFREVSGSAEQ--LLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGR 751
            :.|.||.|...|.:|.|....||.  .|:.|..|.:.  ..||:||||..||:|||::|....||
Mouse   554 EQGILENIQRNKLLFIETQDGAETSVALEKYQEACEN--GRGAILLSVARGKVSEGIDFVHHYGR 616

  Fly   752 AVLVVGLPYSNSLSPELRQRMQHLDEKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLL 816
            ||::.|:||..:.|..|:.|:::|.::. ....|::.....::...||:|||:|...||..:...
Mouse   617 AVIMFGVPYVYTQSRILKARLEYLRDQF-QIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFA 680

  Fly   817 DKRFADPKIRGKLPKWISRHIVEAN 841
            |||||....|||||:||..|:.::|
Mouse   681 DKRFARADKRGKLPRWIQEHLTDSN 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 176/739 (24%)
DEXDc2 16..394 CDD:214693 59/261 (23%)
Helicase_C_2 659..836 CDD:290046 66/179 (37%)
Ercc2NP_031975.2 rad3 7..708 CDD:273169 177/741 (24%)
DEXDc2 8..280 CDD:214693 62/283 (22%)
DEAH box 234..237 3/3 (100%)
HBB 272..413 CDD:284245 30/168 (18%)
Mediates interaction with MMS19. {ECO:0000250} 438..637 61/204 (30%)
HELICc2 542..686 CDD:214694 51/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.