DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and brip1

DIOPT Version :8

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_002933884.1 Gene:brip1 / 100489959 XenbaseID:XB-GENE-492370 Length:1229 Species:Xenopus tropicalis

Alignment Length:980 Identity:248/981 (25%)
Similarity:393/981 (40%) Gaps:239/981 (24%)


  Fly     1 MSQYTPNQRLDTPGAQEFGFPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALT 65
            :|:|       |.|..:..||...|..|..:|..:.:.|...|..:.|||||:||||.|.|.||.
 Frog     5 LSEY-------TIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALA 62

  Fly    66 WLARHEELVRTEMLARIRGVEQELAK------------LKEESEQS---------------SNWL 103
            |    ::.:..:.....:..|:|..|            |:...|.|               ||:.
 Frog    63 W----QQSLYGKQAVDEKSNEKECTKMERVTPCCCSCHLRNSDELSFNSSNRQMNSTDSTPSNFQ 123

  Fly   104 ESQGKSRAQRAELLRLQHLQALLDKQEQQLDQIRKGAKKHKRQGRVHPGKLEEL----------- 157
            .:........|:|...:....:.|:.:......::..:.|..|.:....:..|.           
 Frog   124 GASSNKTTLAAKLCAKKQASFIADQDDDFQTDRKRIRQSHDEQQQAKKRRCYEKGVQFIDDDFNR 188

  Fly   158 -EKDLDPESD-------------SDSEHET-------ADGPQEAAEDRY------------RPVQ 189
             ..|||..:.             |.|.|..       .|| |...||:.            :..:
 Frog   189 NHTDLDSHNQKKASMDSCPEVIASSSNHSVGPCSLCLCDG-QTKEEDKAIEKGKKENGEKPKVPK 252

  Fly   190 IFFCSRTHSQLAQIVAELRKTPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKA 254
            |||.:|||.|:|||..|||:|.: .|||...|.||:..|.:|.:...:     ||:|        
 Frog   253 IFFGTRTHKQIAQITRELRRTAY-SSVRMTILSSREHTCVHPDIHSNR-----NEKC-------- 303

  Fly   255 RPNPSKKSRLTAEANSRCPFKAASLVESLRDLAL-------TEPLDIEELANEGTACGGCSYYAS 312
                  |..|.|:....|.|...  |:.:.:..|       .:..|||||...|.....|.|:|:
 Frog   304 ------KELLEAKDGHSCRFYHG--VQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAA 360

  Fly   313 RSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKV 377
            |..::.|.::..||..||....|..:.|.|:|.:||:|||||:.|...:......|.:||..|:.
 Frog   361 RELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASFSCSDEQLMYARD 425

  Fly   378 QISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSNGCSMMRTYELTAEGDFFNIDL 442
            :|....:|.                      :::.|..              .|.|        :
 Frog   426 EIDSMVNHG----------------------IRVSDHE--------------PLRA--------V 446

  Fly   443 CELLDFCARTRFARKVQGRADRMEREPRPSENQAPVSTARSL--ILQRL----ASEQKLKEKTKS 501
            |..|     |.:.|:...:.  :|||   .|....|...:.:  |...:    |:...||....:
 Frog   447 CYSL-----TNWIRECSDQL--VERE---YEASCKVWNGKEILAIFHDMGITNATFPLLKANLAA 501

  Fly   502 VKRRVEDINKEDKAEELQEQQK----PTKKPVEEVAPSPIRPLLAFLETLTSN----AEDGRI-- 556
            |      :.||:|...|..|:.    ||..|..::.   ::.|...|:.|...    |||.||  
 Frog   502 V------VEKEEKITMLHGQENVIKIPTLSPQTQMV---LKGLFLVLDYLFRQNNRFAEDYRIAL 557

  Fly   557 -----------LVDPVG-----------------GTLKYILLDPAEQFADIVAEARAIVIAGGTM 593
                       :.|..|                 .||.:..|:||..|:|:.:.||.||:..||:
 Frog   558 QQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSSNARTIVLTSGTL 622

  Fly   594 QPTKELKEQL---FTGCHDRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLREL 655
            .|......:|   |:      ::...|||:....:....:..||.|..|...|.|..:.:...|:
 Frog   623 SPMGSFSSELGVKFS------IQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEI 681

  Fly   656 SMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSG----SAEQLLDN 716
            ..:|.::||.|..||:||||||:.|:|:......:|..|.:...|:|.:|..|    ..:::|..
 Frog   682 GALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQM 746

  Fly   717 YALAIK-RPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSN--SLSPELRQRM--QHLD 776
            |..||: :....||||::|..||:||||:|:|:..|||:.||:|:.|  .|..||:::.  ||..
 Frog   747 YYDAIRYKGEKDGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAK 811

  Fly   777 EKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRF-ADPKIRGKLPKWISRHIVEA 840
            .: |...|:::||....:|:||.:||.:||..|:..:.|:|.|| ::||....|.||:.:.:...
 Frog   812 SR-GLLPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPKYITGLSKWVRQLVQHH 875

  Fly   841 NAANG 845
            :..||
 Frog   876 STFNG 880

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 242/961 (25%)
DEXDc2 16..394 CDD:214693 111/456 (24%)
Helicase_C_2 659..836 CDD:290046 70/187 (37%)
brip1XP_002933884.1 rad3 246..885 CDD:273169 198/728 (27%)
DEAD_2 255..420 CDD:284209 59/187 (32%)
Helicase_C_2 685..870 CDD:290046 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.