DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and AT4G37420

DIOPT Version :10

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_195458.1 Gene:AT4G37420 / 829896 AraportID:AT4G37420 Length:588 Species:Arabidopsis thaliana


Alignment Length:161 Identity:26/161 - (16%)
Similarity:44/161 - (27%) Gaps:71/161 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 IY--AYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLR----------------------- 344
            ||  |:.....||..|.:.|...|  .:.....|:||..|:|                       
plant    66 IYRAAFFATTRPAKSRFVSYVINT--QDSNHHQLSNGSRRIRAEAVLWPGWEILVIVSPEEKAKP 128

  Fly   345 ------HYQHMLLQHRKLEKRLNELIPYND-----CFYRNLYRHDY------------------- 379
                  :|........|...|...::|:::     |....:|||.:                   
plant   129 PPFPGENYICFYPNGEKSTARFAAILPFSNRASFRCSLPGIYRHHHPIPTPILASSKRFQLSPET 193

  Fly   380 --------------LVNVDVDEVIMPLGDNR 396
                          .::.:.|.|::..|.||
plant   194 RWPDLPLWNFVVFEAISTETDVVLLVKGPNR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:426386 26/161 (16%)
AT4G37420NP_195458.1 Glyco_transf_92 311..541 CDD:426386
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.