DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and Y18H1A.14

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001021733.2 Gene:Y18H1A.14 / 3565894 WormBaseID:WBGene00044461 Length:467 Species:Caenorhabditis elegans


Alignment Length:391 Identity:72/391 - (18%)
Similarity:127/391 - (32%) Gaps:157/391 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LKGFDF-PYVDLSERLIEWFELQRILGASRIYAYM-------YDVH--PAVQRV----------L 320
            |..|.| ||..|.|:|        |:....:|.::       ..:|  ||::||          |
 Worm     7 LNNFQFKPYSVLYEQL--------IIRCRTLYLFVILLAFVHISIHPLPALRRVRNSYTNKIKEL 63

  Fly   321 D-----------YYQRTGY-LELRPLTLANGMPRLRHYQHMLLQHRKL-------------EKRL 360
            |           ||...|| |....:||....||..|:     :.||:             ..::
 Worm    64 DNDEKDLFFVSAYYYGVGYSLYKNQVTLTFIAPRDAHW-----ERRKIIAIRSDDTKTVLEPLQI 123

  Fly   361 NELIPYNDCFY----------RNLYRHDYLVN---------------VDVDEVIMPLGDNRNWHQ 400
            :...|:|.|.|          ..|...:.|||               .|:.....|:.:|..|..
 Worm   124 HRATPHNLCKYVTLVGTIVLEEELTELELLVNGHTAKIRYLPADNKPKDLVVCTPPIYNNVRWQN 188

  Fly   401 LVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEEQAIAGE----LYVLQHTQRIKNY 461
            ::..||                          |.|.|..|.:..:|..    ...|:..:|:|..
 Worm   189 VLLAAH--------------------------VYTSFGGHLQTYVATTSRPFFEFLEELKRLKGI 227

  Fly   462 SMP------GRA--------------TKCFHNARLS---LTLHNHFTLKWLPGGCNPRTLNTSIA 503
            |:.      |::              :.|.:..:.|   :|.     |:| .....|::.::..:
 Worm   228 SVDSFPDFYGKSKLDGIEFGGVTVANSDCLNKYKSSGSFITF-----LEW-SDLLVPKSFDSYFS 286

  Fly   504 QMQHYREPDDKYNLTNLTDDRSVWKFAGELRAAVEYVWLHLDDVLAQVSDPEE-----QQQQLEE 563
            :..:|.|.:....|....::|.|.|.... .:.::.|||         ::|.|     :.:|:::
 Worm   287 EFANYYESEIFVGLLEYRNERGVAKVVTR-PSLIDSVWL---------NEPVEHPYKLKSKQMDD 341

  Fly   564 S 564
            |
 Worm   342 S 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 68/371 (18%)
Y18H1A.14NP_001021733.2 Glyco_tranf_GTA_type 171..340 CDD:386096 34/210 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.