DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and C35A5.10

DIOPT Version :10

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001023700.1 Gene:C35A5.10 / 3565313 WormBaseID:WBGene00044016 Length:286 Species:Caenorhabditis elegans


Alignment Length:36 Identity:11/36 - (30%)
Similarity:14/36 - (38%) Gaps:10/36 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 AHALEVEKGGKCA-GRFPA---------LCFINSYF 430
            :..|...|.|.|. |..|.         ||:.:|||
 Worm   250 SQVLSTTKLGPCVDGACPLPGYTCGVGDLCYPDSYF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:426386 11/36 (31%)
C35A5.10NP_001023700.1 None

Return to query results.
Submit another query.