powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG11384 and M02F4.2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_569887.1 | 
            Gene: | CG11384 / 31061 | 
            FlyBaseID: | FBgn0040363 | 
            Length: | 588 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_508519.2 | 
            Gene: | M02F4.2 / 187401 | 
            WormBaseID: | WBGene00019736 | 
            Length: | 135 | 
            Species: | Caenorhabditis elegans | 
          
        
        
        
          
            | Alignment Length: | 34 | 
            Identity: | 10/34 - (29%) | 
          
          
            | Similarity: | 13/34 -  (38%) | 
            Gaps: | 7/34 - (20%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   480 LHNHFTLKWLPG-------GCNPRTLNTSIAQMQ 506 
            ||:.|..||..|       ...|...:..:|.|| 
 Worm    40 LHHRFDAKWKRGEEVEKLFTYFPNNTSAHVASMQ 73 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | 
            External ID | Identity | 
          
          
            | CG11384 | NP_569887.1 | 
            Glyco_transf_92 | 
            271..551 | 
            CDD:279961 | 
            10/34 (29%) | 
          
          
            | M02F4.2 | NP_508519.2 | 
            None | 
          
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D561250at33208 | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 1.010 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.