DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and M02F4.2

DIOPT Version :10

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_508519.2 Gene:M02F4.2 / 187401 WormBaseID:WBGene00019736 Length:135 Species:Caenorhabditis elegans


Alignment Length:34 Identity:10/34 - (29%)
Similarity:13/34 - (38%) Gaps:7/34 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 LHNHFTLKWLPG-------GCNPRTLNTSIAQMQ 506
            ||:.|..||..|       ...|...:..:|.||
 Worm    40 LHHRFDAKWKRGEEVEKLFTYFPNNTSAHVASMQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:426386 10/34 (29%)
M02F4.2NP_508519.2 None

Return to query results.
Submit another query.