powered by:
Protein Alignment CG11384 and M02F4.2
DIOPT Version :9
Sequence 1: | NP_569887.1 |
Gene: | CG11384 / 31061 |
FlyBaseID: | FBgn0040363 |
Length: | 588 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508519.2 |
Gene: | M02F4.2 / 187401 |
WormBaseID: | WBGene00019736 |
Length: | 135 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 10/34 - (29%) |
Similarity: | 13/34 - (38%) |
Gaps: | 7/34 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 480 LHNHFTLKWLPG-------GCNPRTLNTSIAQMQ 506
||:.|..||..| ...|...:..:|.||
Worm 40 LHHRFDAKWKRGEEVEKLFTYFPNNTSAHVASMQ 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11384 | NP_569887.1 |
Glyco_transf_92 |
271..551 |
CDD:279961 |
10/34 (29%) |
M02F4.2 | NP_508519.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D561250at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.