DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and M02F4.2

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_508519.2 Gene:M02F4.2 / 187401 WormBaseID:WBGene00019736 Length:135 Species:Caenorhabditis elegans


Alignment Length:34 Identity:10/34 - (29%)
Similarity:13/34 - (38%) Gaps:7/34 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 LHNHFTLKWLPG-------GCNPRTLNTSIAQMQ 506
            ||:.|..||..|       ...|...:..:|.||
 Worm    40 LHHRFDAKWKRGEEVEKLFTYFPNNTSAHVASMQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 10/34 (29%)
M02F4.2NP_508519.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.