DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and K06H6.4

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_503251.3 Gene:K06H6.4 / 187073 WormBaseID:WBGene00019452 Length:500 Species:Caenorhabditis elegans

Alignment Length:481 Identity:87/482 (18%)
Similarity:166/482 (34%) Gaps:132/482 (27%)


  Fly   135 DKRKGLKLPTVRILATANQIDNEFP-----PTHCQMWFEGYRQ--PIFVPVAEFLSVWVEAWGNK 192
            |..|...||...:..|... :||.|     ...|.  :|.:.|  ...:|..|....|:.:|  |
 Worm    50 DLTKVAALPPESLFNTTTD-ENEDPLFAYNSFDCP--YEEWNQVTTTIIPNTEVHENWMRSW--K 109

  Fly   193 PNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVAR------------------------------- 226
            |...       |......|..:::|.:...:|..                               
 Worm   110 PEKQ-------PFLYHTKPSAMSAFAQKDQIVVALTSASLINSTMYCRYYDCRRREISDPFQNVI 167

  Fly   227 -HCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVCLKGFDFPYVDLSE-- 288
             |......:||.|   .:.:.|.....:.|:.....:...|:....|.||:...   |.|..:  
 Worm   168 FHKSTVFCALRPN---AKYIAVSATSDETPEYSVPIVPRINKPPHYFTVCMAPL---YGDEPKFL 226

  Fly   289 RLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHM---- 349
            :::::.|..::.||:..:.|:.:|....:.:||.|.:||.:|:           ::.:.|.    
 Worm   227 QIVDFIEYHKLQGATFFHIYLRNVTDYDRMMLDEYVKTGDIEI-----------IKMHDHFWRAD 280

  Fly   350 LLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGG 414
            .:.|.         :..|||.:|:.|...:...:|:||.:    :.|| .|.......|:.....
 Worm   281 YMWHD---------VQINDCHHRSKYFSKWTALIDIDERL----EIRN-EQFKTVVDYLDSIHNA 331

  Fly   415 KCAG-RFPALCFINSYFTKVPTEFSNHEEQAIAGEL--YVLQHTQRIKN-YSMPGRATKCF---H 472
            ..|. ||.....|..  ...|..:.|  ::.|..|:  :..|:|.::.| :..|    ||.   .
 Worm   332 SIANLRFRVKWVIKD--NNTPERYEN--DKQITDEMLFHKYQNTSQLGNFFDQP----KCIIRPE 388

  Fly   473 NARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYREPDDKYNLTNLTDDRSVWKFAGELRAAV 537
            |..: :|:|...|:.   .|....:::..|..::|||..:.:.             |.|.|...:
 Worm   389 NVAI-MTIHGPLTMY---KGERITSVDKDIGFIRHYRSVEQRV-------------FPGALERMM 436

  Fly   538 EYV---------WLH---LDDVLAQV 551
            ::.         |:.   .:::|::|
 Worm   437 KHAPFNILPVEQWIEKNLTENILSRV 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 58/305 (19%)
K06H6.4NP_503251.3 Glyco_transf_92 209..454 CDD:279961 57/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17153
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.