DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F59C6.8

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_492748.3 Gene:F59C6.8 / 186606 WormBaseID:WBGene00010327 Length:515 Species:Caenorhabditis elegans

Alignment Length:339 Identity:67/340 (20%)
Similarity:112/340 (33%) Gaps:123/340 (36%)


  Fly    95 YKINKTCAVYPDPLDL---QLHNIYWQTFVNANVTFRLYAAYLDKRKGLKLPTVRILA---TANQ 153
            ||......|:|||.|:   .|...|::.|..|   |:::            ||...:.   |...
 Worm   258 YKEAAEFIVFPDPDDILVPVLGKNYYEEFTQA---FKMF------------PTAGAVVYNMTQTS 307

  Fly   154 IDNEFPPTHCQMWFEGYRQPIFVPVAEFLSV---WVEAWGN---KPN------LNYPHLLSCPVP 206
            |::...|.            ::.|::...|:   ..:.||.   :|.      ::..:.:.....
 Worm   308 IESSMTPA------------LYSPISMLASMKFKGEQKWGKLVVRPERVDSTWIHRSYAIKEGFE 360

  Fly   207 SELPPPTVNSFPKTVSLVARHCEKAGNSLRV-------NMNRKQSLPVVIPPSQNPKSQNAT--- 261
            .::.|..||:|               ..||:       ..||.:   :..||..:|...|||   
 Worm   361 QKVMPVDVNAF---------------YHLRIWKFPEVPTFNRSK---ISNPPFFDPYHLNATKRA 407

  Fly   262 ---------IQSQNEALQNFGVCLKGFD-FPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAV 316
                     ||.:.:...:.|.....:. .|.|.|...|||       :..:||:..|.|:  ..
 Worm   408 IYKISDGLKIQRKFKNRVSQGTMKTIYSRLPKVSLYYPLIE-------VCYNRIFYSMKDI--GT 463

  Fly   317 QRVLDYYQRTGYLELRPLTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLV 381
            .|..:|.....:..||...:|                       :|.:.|..  |||:|.|. |:
 Worm   464 CRGPEYCNIPAFPGLRCTNVA-----------------------SEFVTYKS--YRNIYIHQ-LI 502

  Fly   382 NVDVDEVIMPLGDN 395
            :.|.:|     |||
 Worm   503 STDFEE-----GDN 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 29/127 (23%)
F59C6.8NP_492748.3 Glyco_transf_92 163..375 CDD:279961 27/159 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.