DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F54D10.8

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_494663.2 Gene:F54D10.8 / 186235 WormBaseID:WBGene00018809 Length:457 Species:Caenorhabditis elegans

Alignment Length:470 Identity:90/471 (19%)
Similarity:172/471 (37%) Gaps:122/471 (26%)


  Fly   129 LYAAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQPIFVPVAEFLSVWVEAWGNKP 193
            ||..|:.|.....|.....:|:.||:       |....|:.|        .:..|.|:  | .:.
 Worm    22 LYKDYVQKSYSRNLDGKCHVASWNQV-------HTDSEFQSY--------IDMFSRWL--W-RRL 68

  Fly   194 NLN-----------------YPHLLSCPVPS------------------ELPPPTVNS--FPKTV 221
            ||:                 ||.|:|..:.|                  ||......|  ||::|
 Worm    69 NLSVENNQNYTSTSILGAYVYPKLISISLTSQYLSQQKIYCRYYDCKRRELLGSAYESVVFPESV 133

  Fly   222 SLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVC---LKGFDFPY 283
            .    ||.:...:..|:::...:       |..|:....:.::.:|.:.:..||   |.|.:..:
 Worm   134 V----HCPRRAGAEFVSVSSGFN-------SSTPEPVRLSFKAYDEPVHDLSVCVAPLYGNESKW 187

  Fly   284 VDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQH 348
            :    :::::.|..::.||:..|.|:..::...:::|..|.|||.:|:  ..|.:...|..:..|
 Worm   188 L----QIVDFVEHMKLEGATYFYFYVGTINDYDRKMLTEYVRTGDVEV--TFLQDKFERPAYAWH 246

  Fly   349 MLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKG 413
            :|:.              .||..|:.|...::..:|:||.|   .....::.|::     .:|..
 Worm   247 LLMM--------------QDCHLRSKYHSKWITFLDLDERI---SSGTEYNNLLE-----VIESQ 289

  Fly   414 GKCAGRFPALCFINSYFTKVPTEFSNHEEQAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSL 478
            .:..|...........:...|.:|::.|:  :..::...:.|..|   .....|:|.........
 Worm   290 PRSVGELHVSVLNILKYEDTPEKFTSMEQ--LKEDMMFRKWTNTI---DPTWNASKAIVRPEQIG 349

  Fly   479 TLHNHFTLKWLPGGCNPRTLNTSIAQMQHYRE-------PDDKYNLTNLTDDRSV--WKFAGE-- 532
            .:..|:.:. ...|.|...||.|.|.::|||.       ||  ::.|..|...:|  |....|  
 Worm   350 IMFIHYAIA-KQFGVNTVKLNASQAAVRHYRNTLHRMEAPD--WHPTAPTKSPTVQRWPLKPEFV 411

  Fly   533 ------LRAAVEYVW 541
                  :.|.|::|:
 Worm   412 ESLSNAIVAKVQHVY 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 57/292 (20%)
F54D10.8NP_494663.2 Glyco_transf_92 171..410 CDD:279961 54/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.