DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F46F5.7

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_493820.1 Gene:F46F5.7 / 185860 WormBaseID:WBGene00018498 Length:465 Species:Caenorhabditis elegans

Alignment Length:595 Identity:99/596 (17%)
Similarity:187/596 (31%) Gaps:211/596 (35%)


  Fly     7 FIRLTILVTVAVLAIFVLLSALQRTDHLKPTPLGQYGVSVEAGLAAKVTPPPIRHLEEPIK--EE 69
            ||.:|||: :.|..||:....|..:..:.|              .....||....|...|:  |:
 Worm    17 FILITILL-LLVFDIFLNKPELFPSSRISP--------------CYSEPPPASGKLNSTIEKSED 66

  Fly    70 LVRQLE-QELPEVDY---GF-WYHWAKPMGYKINK----------TCAVYPDPLDLQLHNIYWQT 119
            |:..|. .:|....|   || .:.|.:...:|..|          |...|....::.:....|. 
 Worm    67 LLNVLSTMDLSNQTYFIDGFDRFDWYRSQLFKQTKGRSKRASNISTLFAYEFEHEITVTTTSWN- 130

  Fly   120 FVNANVTFRLYAAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQPIFVPVAEFLSV 184
                .:..|:|..|||.               |.::...|       ||                
 Worm   131 ----RMGHRVYCRYLDD---------------NNVEIGIP-------FE---------------- 153

  Fly   185 WVEAWGNKPNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRVNMNRKQS----- 244
                     :|.||..::                        .|:|...:.::.::.::.     
 Worm   154 ---------SLTYPEYIA------------------------SCKKREGTRKIGLSVERDGDFVP 185

  Fly   245 LPVVIPPSQNPKSQNATIQSQNEALQNFGVCLKGF--DFPYVDLSERLIEWFELQRILGASRIYA 307
            ||::....:.||.:             ..:|:...  |.|...:...|||.::||   |....|.
 Worm   186 LPIIDRMLKKPKYE-------------LSMCIASIYGDEPKWLMFIELIEHYKLQ---GVQHFYL 234

  Fly   308 YMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYR 372
            :::........|::.|.|||.:|:..| :...|....|:|               ::...||...
 Worm   235 HIHHASEYDMAVINDYVRTGEVEVHYL-IERDMRTDDHWQ---------------MVSIADCLIW 283

  Fly   373 NLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEF 437
            :.....:.:..|:||.|.    ..|:...:.. :..:::.....:.:|.....:.:..|  |.::
 Worm   284 SRGETKWTIFADLDERIY----MTNYTGTILD-YVRDIKNESIASIQFRQQWIMKTELT--PPKY 341

  Fly   438 SNHEEQAIAGELYVLQHTQRIKNYS---MPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLN 499
            ...      |:|.....|:|..|.|   .||...||..:......:..|:..::.|.        
 Worm   342 EGD------GQLDKWMPTRRWHNSSGIGSPGHTAKCIVDTSKVFIMFVHYVTQFFPA-------- 392

  Fly   500 TSIAQ------------MQHYREPDDKYNLTNLTDDRSVW-----------------KFAGEL-- 533
            |::::            ::|||:       .:|.|...:|                 :|.|:|  
 Worm   393 TNVSEYVQMRVDPEEGLVRHYRD-------LSLGDWGRIWLNTTLQFGALRNTDYPSEFLGKLTE 450

  Fly   534 --RAAVEYVW 541
              :...:||:
 Worm   451 NVKRRAKYVY 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 54/310 (17%)
F46F5.7NP_493820.1 Glyco_transf_92 198..448 CDD:279961 51/310 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.