DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F41D3.8

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_493097.1 Gene:F41D3.8 / 185608 WormBaseID:WBGene00009613 Length:133 Species:Caenorhabditis elegans

Alignment Length:120 Identity:23/121 (19%)
Similarity:40/121 (33%) Gaps:32/121 (26%)


  Fly   378 DYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEE 442
            |||...   ..:.||.|:..:.|....:..|.:....|.....|..|.:   |..||        
 Worm    43 DYLHQA---STLSPLSDSHPFKQKDLDSPELSLLNYEKSLWIIPEPCRV---FINVP-------- 93

  Fly   443 QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRT 497
                    |::||          |..:|...:.::...:|..:..::.|..:|.|
 Worm    94 --------VVKHT----------RGEECIGKSVITGKSYNFTSNNFISGSRHPAT 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 23/121 (19%)
F41D3.8NP_493097.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.