DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F41D3.8

DIOPT Version :10

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_493097.1 Gene:F41D3.8 / 185608 WormBaseID:WBGene00009613 Length:133 Species:Caenorhabditis elegans


Alignment Length:120 Identity:23/120 - (19%)
Similarity:40/120 - (33%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 DYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEE 442
            |||...   ..:.||.|:..:.|....:..|.:....|.....|..|.:   |..||        
 Worm    43 DYLHQA---STLSPLSDSHPFKQKDLDSPELSLLNYEKSLWIIPEPCRV---FINVP-------- 93

  Fly   443 QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRT 497
                    |::||          |..:|...:.::...:|..:..::.|..:|.|
 Worm    94 --------VVKHT----------RGEECIGKSVITGKSYNFTSNNFISGSRHPAT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:426386 23/120 (19%)
F41D3.8NP_493097.1 None

Return to query results.
Submit another query.