powered by:
Protein Alignment CG11384 and F41D3.8
DIOPT Version :9
| Sequence 1: | NP_569887.1 |
Gene: | CG11384 / 31061 |
FlyBaseID: | FBgn0040363 |
Length: | 588 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_493097.1 |
Gene: | F41D3.8 / 185608 |
WormBaseID: | WBGene00009613 |
Length: | 133 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 120 |
Identity: | 23/120 - (19%) |
| Similarity: | 40/120 - (33%) |
Gaps: | 32/120 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 378 DYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEE 442
|||... ..:.||.|:..:.|....:..|.:....|.....|..|.: |..||
Worm 43 DYLHQA---STLSPLSDSHPFKQKDLDSPELSLLNYEKSLWIIPEPCRV---FINVP-------- 93
Fly 443 QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRT 497
|::|| |..:|...:.::...:|..:..::.|..:|.|
Worm 94 --------VVKHT----------RGEECIGKSVITGKSYNFTSNNFISGSRHPAT 130
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG11384 | NP_569887.1 |
Glyco_transf_92 |
271..551 |
CDD:279961 |
23/120 (19%) |
| F41D3.8 | NP_493097.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4735 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.