DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and R05A10.6

DIOPT Version :8

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_502716.2 Gene:R05A10.6 / 178370 WormBaseID:WBGene00011023 Length:460 Species:Caenorhabditis elegans

Alignment Length:407 Identity:72/408 (18%)
Similarity:139/408 (34%) Gaps:130/408 (32%)


  Fly   217 FPKT--VSLVARH------------CEK---AGNSLRVNMNRKQSLPVVIPPS--QNPKSQNAT- 261
            :|:|  :||:.:|            ||:   .|::.|         .||.|.|  :.|:...|. 
 Worm    91 YPETIAISLITQHMLNQKMYCRYYDCERNEIPGSAWR---------GVVFPESVIECPRRIGAVY 146

  Fly   262 ------------------IQSQNEALQNFGVCL-----KGFDF-PYVDLSERLIEWFELQRILGA 302
                              .::..|.:....||:     .|..: |.||..|.       .::.||
 Worm   147 VSVSREMEEVAPTPVRLKFRAYKEPVHQLSVCMAPTYGNGSHWLPIVDFVEH-------NKLEGA 204

  Fly   303 SRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYN 367
            :..:.|...:....:::|:.|.|||.:||..|.        ..||.:.:..:.||        ..
 Worm   205 TFFFFYAGQIRKYDEKILNEYVRTGDMELVKLQ--------DKYQRVFISWQFLE--------VQ 253

  Fly   368 DCFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTK 432
            ||..|:.|...:...:|:||.:...|     .:::....:::          .|::..::.....
 Worm   254 DCHLRSKYFSKWTAVIDLDERMTTFG-----QRMIDLLRSIQ----------DPSIGVLDVPHVH 303

  Fly   433 V------PTEFSNHEEQAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPG 491
            |      |.:|.|..:  :..||...::.:...|.....:.  .....::.:.|.:.....|  .
 Worm   304 VIQNDDFPAKFENRTQ--LEKELIFKKYNKTTSNQITGSKF--IIRPDKIGVMLIHEIVGMW--P 362

  Fly   492 GCNPRTLNTSIAQMQHYREPDDKYNLTNLTDDRSVWKFAGELRAAVEYVWLHLDD------VLAQ 550
            |...:.|:.:.|.::|||...::....|                     |..:.|      :...
 Worm   363 GIKLQKLDKAQAVLRHYRSTKNRMYQPN---------------------WNEIPDKFGVMPIFKS 406

  Fly   551 VSDPEEQQQQLEESLDQ 567
            |..||:..:.|||::.|
 Worm   407 VPLPEQFSKDLEEAVVQ 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 49/298 (16%)
R05A10.6NP_502716.2 Glyco_transf_92 173..417 CDD:279961 52/309 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.