DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and CDC33

DIOPT Version :8

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_014502.1 Gene:CDC33 / 854026 SGDID:S000005499 Length:213 Species:Saccharomyces cerevisiae

Alignment Length:201 Identity:74/202 (37%)
Similarity:117/202 (58%) Gaps:11/202 (5%)


  Fly   222 EFLSLNNKCDDDLTIAAENAELLEVEDPQHPLNNCWTLWYLEN--DRNKSWEEMLHKVTSFDTVE 284
            |.:|:::......|:.:::|..    |.:||||..|||||.:.  |:::||.::|..||||.|||
Yeast    12 ENVSVDDTTATPKTVLSDSAHF----DVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVE 72

  Fly   285 KFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLT-KSAKMALDSFWMDAML 348
            :||::|.:|..|.||.|.|||.:|:..:||.||||||..||:|...|. |.|.  :|..|:..:|
Yeast    73 EFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGAD--IDELWLRTLL 135

  Fly   349 CLIGEACKHSD-DLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLH 412
            .:|||.....| .:.|||::||...||.::| ....::..:|.||...::||::.:...||:..|
Yeast   136 AVIGETIDEDDSQINGVVLSIRKGGNKFALW-TKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPH 199

  Fly   413 KDSKDK 418
            ..:..:
Yeast   200 SSANGR 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 64/158 (41%)
CDC33NP_014502.1 CDC33 1..213 CDD:227386 74/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5150048
eggNOG 1 0.900 E1_COG5053
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000440
OrthoInspector 1 1.000 T634585
orthoMCL 1 0.900 OOG5_127278
Panther 1 1.100 O PTHR11960
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R595
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.