DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eIF4E3

DIOPT Version :8

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster

Alignment Length:227 Identity:99/228 (43%)
Similarity:143/228 (63%) Gaps:26/228 (11%)


  Fly   215 VAFDNSLEFLSLNNK------------CDDDLTIAAENAELLEVEDPQHPLNNCWTLWYLENDRN 267
            :|..:.||.:|.|.:            .|.||.:             :|||.:.||||:|||||.
  Fly    32 LAVYDGLELMSGNEEELQPSLNRVMKNIDYDLAM-------------KHPLEHTWTLWHLENDRT 83

  Fly   268 KSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLT 332
            |.|.|||..||||:|||.|:|:...:||||:|.:.:||.:|||.|||||||:.|.|||||::.|.
  Fly    84 KRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLD 148

  Fly   333 KSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRK 397
            |:::..:|..|.|.:||:|||..:|||::||||:|:|.|:||:|:|..|..|...:|.|||.:::
  Fly   149 KASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKE 213

  Fly   398 VLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            :|.: .|..::||:|||:....|..|..|||:
  Fly   214 LLHL-GIMEIQYQVHKDAMVNHGPNVNAIYTL 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 78/154 (51%)
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 78/154 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5150018
eggNOG 1 0.900 E1_COG5053
Homologene 1 1.000 H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1589
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394271at2759
OrthoFinder 1 1.000 FOG0000440
orthoMCL 1 0.900 OOG5_127278
Panther 1 1.100 P PTHR11960
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.