DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and Eif4e

DIOPT Version :8

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_446426.1 Gene:Eif4e / 117045 RGDID:69647 Length:217 Species:Rattus norvegicus

Alignment Length:240 Identity:99/241 (41%)
Similarity:137/241 (57%) Gaps:32/241 (13%)


  Fly   196 LEPRIKQNTCPPAKKEDAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVEDPQ----HPLNNC 256
            :||.....|.||..:|:                |.:.:          .||.:|:    |||.|.
  Rat     4 VEPETTPTTNPPPAEEE----------------KTESN----------QEVANPEHYIKHPLQNR 42

  Fly   257 WTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEAN 321
            |.||:.:||::|:|:..|..::.|||||.||:|..||:..|.||.|.||||||.||.||||||.|
  Rat    43 WALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKN 107

  Fly   322 VNGGRWVINLTKSAKMA-LDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRGKSNKISIWNADGGN 384
            ..||||:|.|.|..:.: ||.||::.:||||||:. .:|||:||.|||:|.|.:||:||..:..|
  Rat   108 KRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECEN 172

  Fly   385 QTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            :..|..|||:.::.|.:....|:.||.|.|:..|.|||.|..:.|
  Rat   173 RDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 76/156 (49%)
Eif4eNP_446426.1 EIF4EBP1/2/3 binding. {ECO:0000250} 37..40 3/3 (100%)
IF4E 38..196 CDD:307672 78/158 (49%)
7-methylguanosine-containing mRNA cap binding. {ECO:0000250} 56..57 1/1 (100%)
EIF4EBP1/2/3 binding. {ECO:0000250} 73..77 2/4 (50%)
7-methylguanosine-containing mRNA cap binding. {ECO:0000250} 102..103 1/1 (100%)
EIF4EBP1/2/3 binding. {ECO:0000250} 132..139 4/7 (57%)
7-methylguanosine-containing mRNA cap binding. {ECO:0000250} 157..162 2/5 (40%)
7-methylguanosine-containing mRNA cap binding. {ECO:0000250} 205..207 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106102075
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H123817
Inparanoid 1 1.050 215 1.000 Inparanoid score I3477
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394271at2759
OrthoFinder 1 1.000 FOG0000440
OrthoInspector 1 1.000 T617871
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11960
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.