DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14628 and CG18823

Sequence 1:NP_569883.1 Gene:CG14628 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_659571.1 Gene:CG18823 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster

Alignment Length:110 Identity:64/111 (58%)
Similarity:76/111 (68%) Gaps:18/111 (16%)


  Fly    15 PTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETLDHTTFKS 79
            ||..:|||.|||||.||||||..||||||:|||||:.:|:|||||||||||..||:.||...|||
  Fly     9 PTSPRSRIWVRNLPPCTRQELVMLCLPFGKILGSLIVDNEGFIQFARESEATSAIDALDQIVFKS 73

  Fly    80 KVILVSNASFRSLNASCLGYAPP---GQMMIEWSDEDDV---DEY 118
            ||:.||||:|           ||   ||::: |.|||.|   ||:
  Fly    74 KVLQVSNATF-----------PPIEGGQVLV-WYDEDGVYFEDEF 106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 47/66 (71%)
RRM_SF 22..85 CDD:240668 45/63 (71%)
CG18823NP_659571.1 RRM <9..>79 CDD:223796 49/70 (70%)
RRM_1 16..76 CDD:278504 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140912137
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D421126at33208
OrthoFinder 1 1.000 FOG0002730
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.