DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14628 and ncoa5

Sequence 1:NP_569883.1 Gene:CG14628 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_005166217.1 Gene:ncoa5 ZFINID:ZDB-GENE-040912-155 Length:622 Species:Danio rerio

Alignment Length:93 Identity:26/94 (28%)
Similarity:46/94 (49%) Gaps:4/94 (4%)


  Fly    12 TSGPTGLKSRILVRNLPVC--TRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETLDH 74
            ::.|..|:.||.|.|||..  .::::..|..|:|:|....:....||:||.|..:|:.|....:.
Zfish    19 SNDPRDLERRIFVGNLPTAHMAKKDMEDLFRPYGKIQALSLFRGYGFVQFERLEDAEAAKAGHNG 83

  Fly    75 TTFKSKVILVSNASFRSLNASCLGYAPP 102
            ..::...:.|:.|:.|..|.|  ..:||
Zfish    84 RVYRGYKLDVNMAAERRQNKS--RSSPP 109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 18/68 (26%)
RRM_SF 22..85 CDD:240668 17/65 (26%)
ncoa5XP_005166217.1 RRM <1..168 CDD:223796 26/94 (28%)
RRM_hnRNPC_like 27..94 CDD:240787 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D421126at33208
OrthoFinder 1 1.000 FOG0002730
OrthoInspector 1 1.000 T128764
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.