DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and Neos

DIOPT Version :9

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster


Alignment Length:97 Identity:44/97 - (45%)
Similarity:59/97 - (60%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEA 65
            ||....||..:|..|...||||.:.|||||||:||..:|.|:|::|||:|..|.||:||..|..|
  Fly     1 MSDPGSAGYNITKDPALAKSRIFLGNLPVCTREELVSICQPYGKVLGSMVQKNYGFVQFETEELA 65

  Fly    66 KLAIETLDHTTFKSKVILVSNASFRSLNASCL 97
            ..|...|..:|||..::.|.|||.:|..|:.:
  Fly    66 NKAASALHKSTFKQNMLTVRNASIKSKAANAI 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 32/65 (49%)
RRM_SF 22..85 CDD:240668 29/62 (47%)
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 38/79 (48%)
RRM_SF 20..78 CDD:388407 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I4678
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.